Mutant Proteins Of The F Protein Of Piv-5 And Piv-2

TITRE

PROTÉINES MUTANTES DE LA PROTÉINE F DE PIV-5 ET DE PIV-2

DOMAINE TECHNIQUE

La présente demande est relative à des protéines mutantes de la protéine de fusion (protéine F) de virus Parainfluenza (PIV) qui sont actuellement répertoriés sous PIV de type 5 (PIV-5 ou PIV5) et PIV de type 2 (PIV-2 ou PIV2). La présente demande est relative à des produits en dérivant, tels que : acides nucléiques, vecteurs, cellules, - inhibiteurs de fusion de type anticorps, aptamères, ARN interférants,

- myélomes, hybridomes, cellules souches et progénitrices.

La présente demande est également relative à ces protéines mutantes et produits en dérivant pour leur utilisation dans des applications médicales et biotechnologiques.

ARRIÈRE-PLAN TECHNOLOGIQUE

Le virus Parainfluenza (PIV) qui est actuellement répertorié sous PIV de type 5 (PIV-5 ou

PIV5) est un virus enveloppé du genre Rubulavirus de la famille des Paramyxoviridae. PIV-5 était précédemment connu sous le nom de SV5 (Simian Virus 5), car son isolement a initialement été réalisé à partir de cultures primaires de cellules de singe. L'hôte naturel de PIV-5 semble toutefois être le chien, chez lequel il cause une toux connue sous le nom de toux de chenil.

Par la suite, quelques isolats de PIV-5 ont été obtenus à partir de prélèvements collectés sur des humains, mais qui ont été placés en culture sur des cellules animales. En outre, aucun symptôme ou maladie n'est associé à PIV-5 chez l'être humain. La question de savoir si l'être humain est effectivement un hôte pour PIV-5 est donc à ce jour toujours sujette à débats.

En tout état de cause, le virus PIV-5 est actuellement considéré comme un virus animal. Le viras Parainfluenza (PIV) qui est actuellement répertorié sous PIV de type 2 (PIV-2 ou PPV2) est également un virus enveloppé du genre Rubulavirus de la famille des Paramyxoviridae. A ce jour, seuls des isolats humains de PIV-2 ont été identifiés (hPIV-2), de sorte que PIV-2 est considéré comme un virus humain.

Les virus PIV-5 et PIV-2 sont très proches l'un de l'autre, tant en terme de séquences d'acides nucléiques, de séquences protéiques, d'organisation, de structure et de morphologie.

Parmi les virus Parainfluenza humains, PIV-2 est le viras le plus proche de PIV-5 qui ait été retrouvé chez l'être humain.

PIV-2 peut être considéré, et est à tout le moins considéré par les inventeurs, comme étant l'équivalent humain de PIV-5.

L'infection par PIV-5 ou PIV-2 conduit à la formation de structures plurinucléaires appelées syncytia, qui résultent de la fusion de cellules de l'hôte infecté.

L'entrée des virus PIV-5 et PIV-2 dans la cellule hôte se réalise par la fusion de l'enveloppe virale avec la membrane cellulaire.

Cette fusion implique deux glycoprotéines virales : la protéine d'attachement hémagglutinine-neuraminidase (HN) et la protéine de fusion (F).

La protéine de fusion F de PIV-5 et PIV-2 est synthétisée sous la forme d'un simple précurseur (FO) et se présente sous la forme d'un homotrimère glycosylé. La protéine de fusion F de PIV-5 et PIV-2 nécessite un clivage protéolytique par des furines de l'hôte pour générer une forme « pré-activée », consistant en deux sous-unités liées par des ponts disulfures : une grande sous-unité Fl carboxy-terminale et une petite sous-unité amino- terminale F2.

La sous-unité Fl est composée d'un peptide de fusion hydrophobe (FP) ainsi que deux domaines répétés en heptades (HR-I et HR-2), présentant une conformation de type superenroulé (« coiled-coil »). Après activation par HN, la protéine de fusion subit un ensemble de changements conformationnels résultants en l'insertion du peptide de fusion dans la membrane cellulaire cible. S'ensuit l'interaction entre les domaines HR-I et HR-2 qui rapproche l'enveloppe virale de la membrane cellulaire (Russell et al. 2006). Ces domaines son connus pour former un fagot (« bundle ») de six hélices très stable constitué d'une structure trimérique super-enroulée (« coiled-coil »), dans laquelle trois domaines HR-I sont liés avec trois domaines HR-2 en orientation antiparallèle. Cette conformation représente la forme de post-fusion de la protéine F (Baker et al. 1999, Sergel-Germano et al. 2000, West et al. 2005).

La protéine de fusion F de PIV-5 et PIV-2 nécessite une protéine HN provenant du même type viral pour qu'il y ait promotion de la fusion (Yao et al. 1997). Toutefois, la nature précise des interactions qui existent entre F et HN n'est encore pas bien connue.

Plusieurs études ont néanmoins montré que certaines souches de PIV-5 et de PIV-2 différent dans leur nécessité de HN pour le déclenchement de la fusion.

Par exemple, Ito et al. 1997 décrivent deux souches de « SV5 » (PIV-5), à savoir W3A et WR, dont les protéines F ne diffèrent que par trois acides aminés (résidus 22, 443 et 516). La protéine F de la souche W3A est capable d'induire la fusion de manière autonome, c'est-à-dire en l'absence de la protéine HN, alors que la protéine F de la souche WR n'en est pas capable.

Ito et al. 1997 indiquent que l'activité fusogène de la protéine F de la souche WR peut être rétablie en remplaçant l'acide aminé en position 22 de cette protéine par un acide aminé Proline.

Ito et al. 2000 suggèrent que l'acide aminé E en position 132 et l'acide aminé A en position 290 de la protéine F des souches W3A et WR pourraient être impliqués dans la capacité de la protéine F de ces souches à être autonome de la protéine HN.

Paterson et al. 2000 indiquent que la présence de l'acide aminé Proline en position 22 de la protéine F de la souche W3A, et la présence de l'acide aminé 443 de la protéine F de la souche WR pourraient augmenter la capacité fusogène de ces souches virales. Russell et al. 2003 indiquent que le fait remplacer les résidus L447 et 1449 de la protéine F de la souche W3A par des acides aminés aromatiques pourrait augmenter l'activité fusogène de la protéine F de cette souche virale.

Gardner et Dutch 2007 indiquent que la mutation I49A de la protéine F d'un virus « SV5 » (PIV-5) de type sauvage aurait un effet pro-fusogène.

Gardner et al. 2007 indiquent que la mutation V402A de la protéine F d'un virus « SV5 » (PIV-5) de type sauvage aurait un effet pro-fusogène.

Concernant la protéine PIV-2, il ne semble pas y avoir de document de l'art antérieur qui décrirait l'introduction de mutation(s) dans la séquence de la protéine F de ce virus, de sorte à tenter d'en accroître l'autonomie et la capacité fusogène.

Par ailleurs, il existe de nombreuses autres protéines virales capables de fusion, telles que par exemple les protéines HA1/HA2 de Influenza, la protéine G des Rhabdovirus, la protéines gp41/gpl20 du VIH.

Les connaissances actuelles concernant les capacités de fusogénicité et d'autonomie de ces différentes protéines virales restent à ce jour très limitées.

En tout état de cause, les connaissances actuelles concernant les protéines de fusion virales n'apportent pas une maîtrise technique qui serait suffisante pour en envisager des applications médicales et/ou biotechnologiques effectives.

RÉSUMÉ DE L'INVENTION

Les inventeurs ont considéré que le fait de disposer d'une protéine de fusion qui serait hyperfusogène et qui ferait également preuve d'une grande autonomie dans sa capacité de fusion permettrait d'apporter une solution à un certain nombre de situations médicales et biotechnologiques.

Les inventeurs ont alors opéré un choix sélectif vis-à-vis de la protéine F de PIV-5 et/ou PIV-2 par rapport à l'ensemble des autres protéines de fusion virales, telles que les protéines HA1/HA2 de Influenza, la protéine G des Rhabdovirits, la protéines gp41/gpl20 du VIH.

Ils ont ensuite construit et produit des protéines F mutantes, qui sont capables de fusogénicité en l'absence de la protéine HN.

Les protéines mutantes de l'invention font preuve d'une forte capacité de fusogénicité et d'une forte autonomie. Elles ne nécessitent pas la présence de la protéine HN pour induire la fusion cellulaire et la formation de syncytia.

Les inventeurs montrent en outre qu'il est possible d'introduire dans ces protéines mutantes un site de clivage différent de celui que présente la protéine F à l'état naturel, et plus particulièrement un site de clivage tissu-spécifique.

Les inventeurs proposent en outre des applications médicales (thérapeutiques, préventives, palliatives, mais aussi diagnostiques) et/ou biotechnologiques des protéines mutantes de l'invention et/ou des produits en découlant ou dérivant.

Plus particulièrement, les inventeurs proposent d'utiliser les protéines mutantes de l'invention ou les acides nucléiques les codant, pour traiter, prévenir ou pallier, par voie in vivo ou par voie ex vivo, les maladies ou dysfonctions pour lesquelles on souhaite induire ou augmenter la formation de syncytia, telles que les cancers (plus particulièrement les cancers métastatiques, préférentiellement les mélanomes métastatiques) ou les déficiences du développement placentaire.

Les inventeurs proposent en outre des agents bloquant la protéine F de PIV-5 et/ou PIV-2, tels que des anticorps, des cellules dendritiques recombinantes, des antisens, des siRNA, des acides nucléiques aptamères, pour traiter, prévenir ou pallier, par voie in vivo ou par voie ex vivo, les maladies ou dysfonctions pour lesquelles on souhaite inhiber ou bloquer la formation de syncytia, telles que les infections à virus enveloppé, les allergies, les maladies auto-immunes, les rejets de greffe.

Les inventeurs proposent en outre des moyens diagnostiques pour détecter la formation excessive, ou au contraire insuffisante, de syncytia. Les inventeurs proposent en outre différents moyens biotechnologiques, notamment pour le criblage de principes actifs capables de diminuer la formation de syncytia.

Les inventeurs proposent en outre des cellules cancéreuses, plus particulièrement des myélomes, qui comprennent une protéine mutante de l'invention. Les inventeurs proposent en outre des hybridomes comprenant une protéine mutante de l'invention. Les cellules cancéreuses, plus particulièrement les myélomes de l'invention, sont capables de fusionner avec une autre cellule, et plus particulièrement avec un lymphocyte B, sans mettre en œuvre de polyéthylène glycol (PEG), ni d'électroporation, ni aucun autre moyen inducteur de fusion. Les cellules cancéreuses, plus particulièrement les myélomes de l'invention, sont capables de fusion autonome.

Les hybridomes de l'invention peuvent être produits par une fusion (de lymphocytes B à des myélomes) qui ne requiert pas la mise en œuvre de polyéthylène glycol (PEG), ni d'électroporation, ni aucun autre moyen inducteur de fusion. En effet, les hybridomes de l'invention peuvent être produits en mettant en œuvre au moins une cellule cancéreuse, plus particulièrement au moins un myélome de l'invention.

Les inventeurs proposent en outre des cellules souches ou progénitrices recombinantes, qui expriment une protéine mutante de l'invention, et leurs applications dans la production de fibres musculaires.

D'autres aspects de l'invention se trouvent décrits en partie « description détaillée » ci- dessous.

BRÈVE DESCRIPTION DES FIGURES

Le jeu de figures de la demande telle que déposée a été déposé en couleurs. Il est accessible par consultation du dossier auprès de l'Office.

Figure IA : séquence de la protéine F de PIV-5 de référence (SEQ ID NO: 31 ; séquence de la protéine F de l'isolât WR) et séquence CDS correspondante (SEQ ID NO : 30 ; séquence d'acides nucléiques codant la protéine de SEQ ID NO : 31). En caractères gras et soulignés au sein de la séquence de SEQ ID NO : 31, sont signalés les acides aminés de positions : - 22 (L),

- 49 (I),

- 132 (E, mutation pré-existante dans cet isolât), - 147 (T); - 158 (T),

- 290 (A, mutation pré-existante dans cet isolât), - 402 (V),

- 443 (P, mutation théoriquement pré-existante dans cet isolât), - 447 (L), - 449 (1), et

- 463 (A).

Figure IB : séquence de la protéine F de PIV-2 de référence (SEQ ID NO: 33 ; séquence de la protéine F de l'isolât Gréer) et séquence CDS correspondante (SEQ ID NO : 32 ; séquence d'acides nucléiques codant la protéine de SEQ ID NO : 33).

En caractères gras et soulignés au sein de la séquence de SEQ ID NO : 33, sont signalés les acides aminés de positions :

- 24 (1),

- 53 (I), - 133 (K),

- 151 (T), - 162 (S), - 294 (1),

- 406 (A), - 428 (S),

- 439 (S), - 445 (I)5

- 474 (S).

Figure 2A : alignement de la protéine F de PF/-5 (acides aminés 4 à 529 de SEQ ID NO: 31) sur celle de PIV-2 (acides aminés 8 à 533 de SEQ ID NO: 33) : l'identité protéique est de 47,7% entre ces deux protéines. La séquence consensus résultant de cet alignement est référencée sous SEQ ID NO: 34. Figure 2B : acides aminé(s) et mutation(s) au sein de la protéine F de PIV-2 qui correspondent à ceux de la protéine F de PIV-5

Figure 3 : illustration de la substitution du site de clivage naturel (SEQ ID NO: 23) de la protéine F de PIV-5 par un site de clivage tissu-spécifique, en l'occurrence par le site d'une enzyme exprimée spécifiquement par le tissu tumoral métastatique, à savoir la métallo-protéase matricielle 9 (MMP-9).

Site consensus d'un site MMP-9 : séquence de SEQ ID NO: 27 (site PXXhyS/T avec X = n'importe quel acide aminé et Hy = n'importe quel acide aminé hydrophobe, c'est-à-dire n'importe quel acide aminé parmi F, M, V, L, I).

Séquence illustrative d'un site MMP-9 : séquence de SEQ ID NO: 28, séquence de SEQ ID NO : 29.

Figure 4 : structure du plasmide pcDNA3.1 sur lequel a été clonée la séquence codant la protéine F de PIV-5.

Amp : gène de résistance à Pampicilline pCMV : promoteur du Cytomégalovirus

MCS : site de clonage multiple (Multiple Cloning Site)

F PIV5 : protéine F de PIV-5 BGHpolyA : signal de poly-adénylation de l'hormone de croissance bovine (Bovine

Growth Hormone polyA)

Figures 5A, 5B, 5C, 5D : visualisation des mutations réalisées par les inventeurs dans la protéine F de PIV-5

Figure 6A : illustration des observations faites au microscope lors des tests de fusion semi-quantitatifs (panel large de mutants réalisés par les inventeurs)

Figure 6B : diagramme présentant les scores de fusion obtenus à l'issue des tests de fusion semi-quantitatifs (panel large de mutants réalisés par les inventeurs)

Figure 7A : illustration des observations faites au microscope lors des tests de fusion semi-quantitatifs (sélection de mutants réalisés par les inventeurs) Figure 7B : diagramme présentant les scores de fusion obtenus à l'issue des tests de fusion semi-quantitatifs (sélection de mutants réalisés par les inventeurs)

Figures 8A, 8B, 8C : résultats des tests de fusion quantitatifs (sélection de mutants réalisés par les inventeurs)

Figure 9 : illustrations des observations faites sous imrnunofluorescence en microscopie confocale pour des protéines mutantes de l'invention présentant un site de clivage autre que le site de clivage naturel de la protéine F de PI V5 (protéines mutantes FusSM et Fus8.7M de l'invention, qui dérivent des protéines mutantes Fus8 et Fus8.7 de l'invention par remplacement du site de clivage naturel par le site de clivage MMP-9 de SEQ ID NO: 28).

DESCRIPTION DÉTAILLÉE

Dans la présente demande, le terme protéine englobe dans sa portée le terme glycoprotéine. C'est notamment le cas pour les protéines F et HN qui sont en fait des glycoprotéines.

Protéine F de PIV-5 et PIV-2 (protéine non mutante^) :

Une séquence de la protéine F de PIV-5 est présentée en Figure IA (séquence protéique de SEQ ID NO: 31 ; séquence acide nucléique codante de SEQ ID NO: 30). Il s'agit de la séquence de l'isolât WR, qui est un isolât simien. Ces séquences sont celles disponibles dans la base de données Genbank sous le numéro AB021962.

L'échantillon d'isolat WR que les inventeurs ont reçu de l'ATCC et qu'ils ont utilisé pour la construction et la production des protéines mutantes décrites dans les exemples ci- dessous ne présentait toutefois pas l'acide aminé P en position 443 de la protéine F (contrairement à ce qui était attendu au vu de la séquence disponible dans Genbank), mais l'acide aminé S. Cette séquence alternative de la protéine F de l'isolât WR est donc identique à la séquence de SEQ ID NO: 31, à l'exception de l'acide aminé en position 443 qui est S et non P. Par souci de concision, cette séquence alternative sera ici notée « SEQ ID NO: 31 avec S en 443 ». La séquence de SEQ ID NO: 31 et la séquence alternative « SEQ ID NO : 31 avec S en 443 », préférentiellement la séquence alternative « SEQ ID NO: 31 avec S en 443 », servent de référence de séquence(s) de protéine F de PIV-5 dans le cadre de la présente demande de brevet.

Ceci étant, il existe bien sûr des isolats de PIV-5 autres que l'isolât WR, et notamment : d'autres isolats simiens, tels que par exemple l'isolât W3A, des isolats d'autres animaux non-humains, tels que : o des isolats canins, par exemple les isolats canins CPI+, CPI-, H221, 78524, Tl, o des isolats porcins, par exemple l'isolât porcin SER, des isolats dits « humains » qui sont issus de prélèvements effectués sur des êtres humains mais qui ont été placés en culture sur des cellules animales (cf. partie introductive ci-dessus), tels que l'isolât MIL, l'isolât DEN, l'isolât LN, l'isolât MEL, et l'isolât qui, dans WO 02 077211, est décrit comme étant un

« cryptovirus ».

Les variations de séquences des protéines F de ces différents isolats PIV-5 sont très faibles.

Une description de ces variations est donnée dans Chatziandreou et al. 2004, dont le contenu, et plus particulièrement le tableau 3 et les commentaires qui y sont associés au cours de cet article, sont incorporés par référence dans la présente demande de brevet.

Le tableau 3 de cet article est ici reproduit :

Dans le tableau 1 ci-dessus, une case vide indique que la protéine F concernée présente le même acide aminé que la protéine F de la souche W3 A indiquée en colonne de gauche. Les acides aminés dont les positions ne sont pas expressément listées dans ce tableau sont bien sûr identiques à ceux qui leur correspondent dans la séquence de la protéine F de W3A. Ces acides aminés sont eux-mêmes identiques à ceux qui leur correspondent dans la séquence de la protéine F de l'isolât WR {cf. séquence de SEQ ID NO: 31). Ainsi, les séquences de SEQ ID NO: 35 à 46 sont les séquences qui résultent du remplacement dans la séquence de SEQ ID NO: 31 des acides aminés indiqués dans le tableau 1 pour chacune de ces séquences (et, le cas échéant, de l'ajout à la séquence de SEQ ID NO: 31 des acides aminés indiqués en partie C-terminale).

La protéine F de l'isolât W3A, ainsi que celle des autres isolats ci-dessus mentionnés, présente :

- en position 147, l'acide aminé T,

- en position 158, l'acide aminé T,

- en position 447, l'acide aminé L, et

- en position 449, l'acide aminé I.

On voit ainsi que les isolats W3A et WR ne présentent pas l'extension cytoplasmique qui, dans les autres isolats, s'étend au-delà de la position 529. Selon l'isolât concerné, cette extension cytoplasmique contient de deux à sept acides aminés.

On voit également que les séquences des protéines F de ces isolats varient de moins de 5% (plus particulièrement, d'au maximum 3%) par rapport à la séquence de la protéine F de la souche WR (sans tenir compte de l'extension cytoplasmique, c'est-à-dire en calculant ce pourcentage sur la longueur de la protéine F de WR) ; cf. fin de page 85 de l'article Chatziandreou et al. 2004.

Une protéine F de PIV-5 peut donc consister en :

- la séquence de SEQ ID NO: 31, ou ladite séquence alternative « SEQ ID NO: 31 avec S en 443 », ou en une séquence variante de cette séquence de SEQ ID NO: 31 ou de cette séquence alternative « SEQ ID NO: 31 avec S en 443 », cette séquence variante pouvant être définie comme :

' o étant d'une taille identique à celle de SEQ ID NO: 31 ou inférieure d'un maximum de 7 acides aminés à celle de SEQ ID NO: 31 ou supérieure d'un maximum de 7 acides aminés à celle de SEQ ID NO: 31 [ladite séquence alternative « SEQ ID NO: 31 avec S en 443 » présente la même taille que la séquence de SEQ ID NO: 31], préférentiellement d'une taille identique à celle de SEQ ID NO: 31 ou supérieure d'un maximum de 7 acides aminés à celle de SEQ ID NO: 31 , et o présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 31 ou à ladite séquence alternative « SEQ ID

NO: 31 avec S en 443 » (cette identité étant calculée sur la longueur de la séquence de SEQ ID NO: 31 ou, le cas échéant, de ladite séquence alternative « SEQ ID NO: 31 avec S en 443 »).

Les séquences variantes de la protéine F de PIV-5 de SEQ ID NO: 31 comprennent notamment les séquences des protéines F des isolats W3A, MIL, DEN, LN, MEL, cryptovirus, CPI+, CPI-, H221, 78524, Tl et SER mentionnés ci-dessus (cf. tableau 1 ci- dessus et article Chatziandreou et al. 2004).

De manière similaire, la séquence qui dans la présente demande sert de référence pour la protéine F de PIV-2 est la séquence de la souche Gréer qui est présentée en Figure IB (séquence protéique de SEQ ID NO: 33, séquence acide nucléique codante de SEQ ID NO: 32).

Il existe bien sûr des isolats PIV-2 autres que l'isolât Gréer, tels que par exemple les isolats Toshiba, V98, V94.

La séquence de la protéine F de ces autres isolats PIV-2 est très proche de celle de l'isolât Gréer, mais présente quelques petites variations qui sont des variations inter-isolats. Ainsi, une protéine F de PIV-2 peut donc consister en : la séquence de SEQ ID NO: 33, ou en

- une séquence variante de cette séquence de SEQ ID NO: 33, cette séquence variante pouvant être définie comme : o étant d'une taille identique à celle de SEQ ID NO: 33 ou inférieure d'un maximum de deux acides aminés à celle de SEQ ID NO: 33 ou supérieure d'un maximum de deux acides aminés à celle de SEQ ID NO: 33, préférentiellement d'une taille identique à celle de SEQ ID NO: 33, préférentiellement étant d'une taille identique à celle de SEQ ID NO: 33, et o présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 33 (cette identité étant calculée sur la longueur de la séquence de SEQ ID NO: 33).

La séquence consensus (SEQ ID NO: 34) résultant de l'alignement de la séquence de la protéine F de PIV-5 (SEQ ID NO: 31) sur celle de PIV-2 (SEQ ID NO: 33) est la suivante peut être lue en figure 2A. Cette séquence consensus peut être re-transcrite comme suit :

le symbole "-" indiquant que les protéines F de PIV-5 et de PIV-2 ont à cette position des acides aminés différents.

Cette séquence consensus peut également être formalisée comme suit :

IXXXXVXXXXXXGXXXXXXXXLXXIGVIXXXXRXLMYYTXXXXXFIVVKL XPXXXXXXXXCNITSXXXYNXTXXKLLXPXXENLXXIXXXXXXXXXRXRF AGVVXGLAALGVATAAQXTAAVAXVKANXNAAAIXNLXXXIQXTNXAVXD VXAXXXXXXTAVQAXQDXINXXXXXXITXAXCXAXDAXIGSILNLYLTEL TTIFHNQITNPALXPVXIQALRILLGSTLPXVXEXXXNTXXXXAELLSSG LLTGQIXXXXXXYMQMXIXIXPTXXXXQPXXXXIDLXXISAXXXXQEVXX QXPXRXXXXXXXXQXYPAXXCXXTPNXVXCRYNXXXXXXXXXXXCLXGNL XXCTFXPXXGXFLXRFXXXXGXXYANCXSXLCXCXXPXXVXXQXXXXXXX XIDXXXCXXXXLDXXXFXITXXXNXTYXXXXXXXXXXIXXXXPLDXSXXX XXXNKSLXXAXXXXAXSXXXXXXXXXAXTXXXLSXIAXLXXXXXLXXXXL LXXXXXKLXXXXXXXRXXXXXXXXHX (SEQ ID NO: 34), avec X = n'importe quel acide aminé.

La séquence de la protéine F de l'isolât WR de PIV-5 est la séquence de SEQ ID NO: 34 précédée des acides aminés MGT à l'extrémité N-terminale {cf. Figures IA et 2A). La séquence de la protéine F de l'isolât Gréer de PIV-2 est la séquence de SEQ ID NO: 34, précédée des acides aminés MHHLHPM (SEQ ID NO: 86) à l'extrémité N-terminale et suivie des acides aminés ENPAFFSKNNHGNIYGIS (SEQ ID NO: 87) à l'extrémité C- terminale (cf. Figures IB et 2A).

La séquence des protéines F de PIV-5 et PIV-2 peut être considérée comme étant une séquence comprenant la séquence de SEQ ID NO: 34, préférentiellement comme étant la séquence d'une protéine F de virus PIV qui comprend la séquence de SEQ ID NO: 34. Plus particulièrement, la séquence des protéines F de PFV-5 et PIV-2 peut être considérée comme étant : a) la séquence de SEQ ID NO: 34 :

" précédée de 3 à 7 acides aminés à l'extrémité N-terminale, plus particulièrement de 3 acides aminés (tels que MGT) ou de 7 acides aminés (tels que MHHLHPM) à l'extrémité N-terminale, et

B éventuellement suivie de 18 acides aminés à l'extrémité C-terminale, plus particulièrement des acides aminés ENPAFFSKNNHGNIYGIS à l'extrémité C-terminale, ou b) une séquence variante de la séquence décrite sous a) ci-dessus, ladite séquence variante étant :

" soit : i. d'une taille identique à celle de SEQ ID NO: 31 ou inférieure d'un maximum de 7 acides aminés à celle de SEQ ID NO: 31 ou supérieure d'un maximum de 7 acides aminés à celle de SEQ ID NO: 31, préférentiellement d'une taille identique à celle de SEQ ID NO: 31 ou supérieure d'un maximum de 7 acides aminés à celle de SEQ ID NO: 31, et ii. présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 31 ou à ladite séquence alternative « SEQ ID NO: 31 avec S en 443 » (cette identité étant calculée sur la longueur de la séquence de SEQ ID NO: 31 ou, le cas échéant, de ladite séquence alternative « SEQ ID NO: 31 avec S en 443 ») ;

" soit : i. d'une taille identique à celle de SEQ ID NO: 33 ou inférieure d'un maximum de deux acides aminés à celle de SEQ ID NO: 33 ou supérieure d'un maximum de deux acides aminés à celle de SEQ ID NO: 33, préférentiellement d'une taille identique à celle de SEQ ID

NO: 33, et ii. présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 33 (cette identité étant calculée sur la longueur de la séquence de SEQ ID

NO: 33).

Protéines mutantes de l'invention :

La présente demande est relative à une protéine mutante, dont la séquence en acides aminés comprend une séquence qui est susceptible de dériver de celle de la protéine F d'un virus PIV-5 ou PIV-2 : - par remplacement :

- de l'acide aminé qui, dans la séquence de ladite protéine F de virus PIV-5, est en position 22, ou qui, dans la séquence de ladite protéine F de virus PIV-2, est en position 24, par l'acide aminé P (mutation 22P dans F de PIV-5 ; mutation 24P dans F de PIV-2), et

- de l'acide aminé qui, dans la séquence de ladite protéine F de virus PIV-5, est en position 132, ou qui, dans la séquence de ladite protéine F de virus PIV-2, est en position 133 (mutation 132E dans F de PIV-5 ; mutation 133E dans F de PIV-2), par l'acide aminé E, et

- de l'acide aminé qui, dans la séquence de ladite protéine F de virus PIV-5, est ' en position 290, ou qui, dans la séquence de ladite protéine F de virus PIV-2, est en position 294, par l'acide aminé A (mutation 290A dans F de PIV-5 ; mutation 294A dans F de PIV-2), et

- de l'acide aminé qui, dans la séquence de ladite protéine F de virus PIV-5, est en position 449, ou qui, dans la séquence de ladite protéine F de virus PIV-2, est en position 439, par l'acide aminé P (mutation 449P dans F de PIV-5 ; mutation 439P dans F de PI V-2),

- et, optionnellement :

- par substitution du site de clivage natif (ou naturel) de ladite protéine F par un autre site de clivage enzymatique, et/ou par insertion dans ladite protéine F d'un site de clivage enzymatique autre que le site de clivage natif (ou naturel) de cette protéine F, et/ou

- par délétion d'une partie C-terminale de ladite protéine F, ladite partie C- terminale s 'étendant en direction N-terminale à partir du dernier acide aminé à l'extrémité C-terminale de la protéine, mais sans s'étendre au-delà du domaine HR2 de ladite protéine F.

Lesdites positions d'acides aminés sont calculées par rapport à la séquence de la forme précurseur (FO) de ladite protéine F (c'est-à-dire la séquence de la protéine F avant clivage), en comptant les positions de l'extrémité N-terminale vers l'extrémité C- terminale.

Les positions indiquées dans la protéine F de PIV-2 sont les positions qui correspondent à celles indiquées dans la protéine F de PIV-5 : cf. figure 2B, donnant le tableau des correspondances de positions.

La séquence de ladite protéine F de virus PIV-5 ou PIV-2 est telle que ci-dessus définie. Elle peut donc être notamment définie comme comprenant la séquence de SEQ ID NO: 34 (séquence consensus des protéines F de PIV-5 et PIV-2).

Protéine mutante de protéine F de PIV-5 : Selon un aspect de l'invention, une protéine mutante de l'invention comprend une séquence qui est susceptible de dériver de celle de la protéine F d'un virus PIV-5.

La séquence de ladite protéine F de PIV-5 est telle que ci-dessus définie. Elle peut notamment consister en :

- la séquence de SEQ ID NO: 31 (séquence de la protéine F de l'isolât WR de PIV-5 présentée en Figure IA), ou de ladite séquence alternative « SEQ ID NO: 31 avec S en 443 », ou en - une séquence variante de cette séquence de SEQ ID NO: 31 ou de ladite séquence alternative « SEQ ID NO: 31 avec S en 443 », cette séquence variante : o étant d'une taille identique à celle de SEQ ID NO: 31 (c'est-à-dire consistant en 529 acides aminés), ou étant d'une taille supérieure d'un maximum de 7 acides aminés à celle de SEQ ID NO: 31 (c'est-à-dire consistant en 530, 531, 532, 533, 534, 535 ou 536 acides aminés), ou étant d'une taille inférieure d'un maximum de 7 acides aminés à celle de SEQ ID NO: 31 (c'est-à-dire consistant en 522, 523, 524, 525, 526, 527 ou 528 acides aminés), et o présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 31 ou à ladite séquence alternative « SEQ ID NO: 31 avec S en 443 », cette identité étant calculée sur la longueur de la séquence de SEQ ID NO: 31 ou (le cas échéant) de ladite séquence alternative « SEQ ID NO: 31 avec S en 443 ».

De préférence, la séquence de ladite protéine F de PFV-5 consiste en :

- la séquence de SEQ ID NO: 31 (séquence de la protéine F de l'isolât WR de PIV-5 présentée en Figure IA), ou ladite séquence alternative « SEQ ID NO: 31 avec S en 443 », ou en - une séquence variante de cette séquence de SEQ ID NO: 31 ou de ladite séquence alternative « SEQ ID NO: 31 avec S en 443 », cette séquence variante : o étant d'une taille identique à celle de SEQ ID NO: 31 (c'est-à-dire consistant en 529 acides aminés), ou étant d'une taille supérieure d'un maximum de 7 acides aminés à celle de SEQ ID NO: 31 (c'est-à-dire consistant en 530, 531, 532, 533, 534, 535 ou 536 acides aminés), et o présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 31 ou à ladite séquence alternative « SEQ ID

NO: 31 avec S en 443 », cette identité étant calculée sur la longueur de la séquence de SEQ ID NO: 31, ou, le cas échéant, de ladite séquence alternative « SEQ ID NO: 31 avec S en 443 ».

Des exemples de telles séquences variantes comprennent notamment la séquence de la protéine F d'un des isolats W3A, MIL, DEN5 LN, MEL, Cryptovirus, CPI+, CPI-, H221, 78524, Tl et SER présentée en tableau 1 dans la présente demande {cf. ci-dessus), c'est-à- dire en l'une des séquences de SEQ ID NO: 35 à 46.

De préférence, la séquence de ladite protéine F de PIV-5 consiste en la séquence de SEQ ID NO: 31 (séquence de la protéine F de l'isolât WR de PIV-5 présentée en Figure IA), ou en ladite séquence alternative « SEQ ID NO: 31 avec S en 443 », très préférentiellement en ladite séquence alternative « SEQ ID NO: 31 avec S en 443 ».

Ladite séquence susceptible de dériver de celle de la protéine F de PIV-5 peut ne pas comprendre de mutation autre que les mutations 22P, 132E, 290A, 449P ci-dessus mentionnées, par rapport à ladite séquence de protéine F de PIV-5. C'est notamment le cas de la séquence de SEQ ID NO: 65 (Fus8).

Alternativement, ladite séquence susceptible de dériver de celle de la protéine F de PIV-5 peut être susceptible de dériver de cette séquence de protéine F par lesdites mutations 22P, 132E, 290A, 449P ci-dessus mentionnées et par au moins une mutation autre que ces mutations 22P, 132E, 290A, 449P ci-dessus mentionnées, préférentiellement par : - au moins une mutation de pré-fusion choisie parmi : - le remplacement de l'acide aminé en position 49 par l'acide aminé A,

- le remplacement de l'acide aminé en position 402 par l'acide aminé A,

- le remplacement de l'acide aminé en position 443 par l'acide aminé P,

- le remplacement de l'acide aminé en position 447 par l'acide aminé P, et/ou par - au moins une mutation de post-fosion choisie parmi :

- le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe.

De préférence, ladite séquence qui est susceptible de dériver de celle de ladite protéine F de PIV-5 est susceptible de dériver de cette séquence de protéine F par lesdites mutations 22P, 132E, 290A, 449P ci-dessus mentionnées, et par : - au moins une mutation de pré-fusion choisie parmi :

- le remplacement de l'acide aminé en position 49 par l'acide aminé A,

- le remplacement de l'acide aminé en position 402 par l'acide aminé A, et/ou par

- au moins une mutation de post-fusion choisie parmi : - le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe.

Ledit acide aminé hydrophobe est avantageusement choisi parmi V, I, L, préférentiellement V.

De préférence, ladite séquence qui est susceptible de dériver de celle de ladite protéine F de PIV-5 est susceptible de dériver de cette séquence de protéine F par lesdites mutations 22P, 132E, 290A, 449P ci-dessus mentionnées, et par :

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe ; et

- au moins une autre mutation de post-fusion, à savoir le remplacement de l'acide aminé en position 463 par un acide aminé hydrophobe, de préférence V, I ou L, plus préférentiellement V. Une telle séquence susceptible de dériver de celle de ladite protéine F peut notamment être une séquence choisie parmi les séquences de SEQ ID NO: 67 à 79 (Fus 10, Fus 10.4, Fusl0.5, Fus 11, Fus8.1, Fus8.2, Fus8.4, Fus8.5, Fus8.6, Fus8.7, FuslO.l, Fusl0.2, Fus 10.3, respectivement) ; cf. tableau 4 ci-dessous.

De préférence, ladite séquence qui est susceptible de dériver de celle de ladite protéine F de PIV-5 est susceptible de dériver de cette séquence de protéine F par lesdites mutations 22P, 132E, 290A, 449P ci-dessus mentionnées, et par au moins une mutation de post- fusion choisie parmi :

- le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe.

Une telle séquence susceptible de dériver de celle de ladite protéine F peut notamment être une séquence choisie parmi les séquences de SEQ ID NO: 68 à 79 (Fusl0.4, Fusl0.5, Fus 11, Fus8.1, Fus8.2, Fus8.4, Fus8.5, Fus8.6, Fus8.7, FuslO.l, Fusl0.2, Fusl0.3, respectivement) ; cf. tableau 4 ci-dessous.

De préférence, ladite séquence qui est susceptible de dériver de celle de ladite protéine F de PIV-5 est susceptible de dériver de cette séquence de protéine F par lesdites mutations 22P, 132E9 290A, 449P ci-dessus mentionnées, et par :

- au moins une mutation de pré-fusion choisie parmi : - le remplacement de l'acide aminé en position 49 par l'acide aminé A,

- le remplacement de l'acide aminé en position 402 par l'acide aminé A, et par

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe. Une telle séquence susceptible de dériver de celle de ladite protéine F peut notamment être une séquence choisie parmi les séquences de SEQ ID NO: 68, 69, 70 (Fusl0.4, Fusl0.5, Fus 11, respectivement) ; cf. tableau 4 ci-dessous.

De préférence, ladite séquence qui est susceptible de dériver de celle de ladite protéine F de PIV-5 est susceptible de dériver de cette séquence de protéine F par lesdites mutations 22P, 132E, 290A5 449P ci-dessus mentionnées, et par les deux mutations de post-fosion, c'est-à-dire par :

- le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe.

Une telle séquence susceptible de dériver de celle de ladite protéine F peut notamment être une séquence choisie parmi les séquences de SEQ ID NO : 76, 78 (Fus8.7, Fus 10.2, respectivement) ; cf. tableau 4 ci-dessous.

Tableau 4 : sélection de protéines mutantes de l'invention (protéines mutantes de protéine F de PIV-5)

Les mutations indiquées dans le tableau 4 peuvent être introduites dans la protéine F de n'importe quel isolât PIV-5, c'est-à-dire de l'isolât WR ou d'un isolât variant. Elles peuvent donc plus particulièrement être introduites dans la séquence de protéine F de SEQ ID NO: 31 présentée en Figure IA (protéine F de WR disponible dans la base de données Genbank sous le numéro AB021962).

Comme indiqué ci-dessus, l'échantillon d'isolat WR que les inventeurs ont reçu de PATCC et qu'ils ont utilisé pour la construction et la production des protéines mutantes décrites dans les exemples ci-dessous ne présentait toutefois pas l'acide aminé P en position 443 de la protéine F (contrairement à ce qui était attendu au vu de la séquence disponible dans Genbank), mais l'acide aminé S. Les mutations indiquées dans le tableau 4 peuvent donc être introduites dans ladite séquence alternative « SEQ ID NO: 31 avec S en 443 » (SEQ ID NO: 65, 67 à 79).

Protéine mutante de protéine F de PIV-2 :

Selon un autre aspect de l'invention, une protéine mutante de l'invention comprend une séquence qui est susceptible de dériver de celle de la protéine F d'un virus PIV-2.

La séquence de ladite protéine F de PIV-2 est telle que ci-dessus définie. Elle peut notamment consister en : - la séquence de SEQ ID NO: 33 (séquence de la protéine F de l'isolât Gréer de PIV-2 présentée en Figure IB), ou en

- une séquence variante de cette séquence de SEQ ID NO: 33, cette séquence variante : o étant d'une taille identique à celle de SEQ ID NO: 33 (c'est-à-dire consistant en 551 acides aminés), ou étant d'une taille supérieure d'un maximum de 2 acides aminés à celle de SEQ ID NO: 33 (c'est-à-dire consistant en 552 ou 553 acides aminés), ou étant d'une taille inférieure d'un maximum de 2 acides aminés à celle de SEQ ID NO: 33 (c'est-à-dire consistant en 549 ou 550 acides aminés), et o présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 33, cette identité étant calculée sur la longueur de la séquence de SEQ ID NO: 33.

De préférence, la séquence de ladite protéine F de PIV-2 consiste en :

- la séquence de SEQ ID NO: 33 (séquence de la protéine F de l'isolât Gréer de PIV-2 présentée en Figure IB), ou en une séquence variante de cette séquence de SEQ ID NO: 33, cette séquence variante : o étant d'une taille identique à celle de SEQ ID NO: 33 (c'est-à-dire consistant en 551 acides aminés), ou étant d'une taille supérieure d'un maximum de 2 acides aminés à celle de SEQ ID NO: 33 (c'est-à-dire consistant en 552 ou 553 acides aminés), et o présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 33, cette identité étant calculée sur la longueur de la séquence de SEQ ID NO: 33.

Plus préférentiellement, la séquence de ladite protéine F de PIV-2 consiste en :

- la séquence de SEQ ID NO: 33 (séquence de la protéine F de l'isolât Gréer de PIV-2 présentée en Figure IB), ou en

- une séquence variante de cette séquence de SEQ ID NO: 33, cette séquence variante : o étant d'une taille identique à celle de SEQ ID NO: 33 (c'est-à-dire consistant en 551 acides aminés), et o présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 33, cette identité étant calculée sur la longueur de la séquence de SEQ ID NO: 33.

Très préférentiellement, la séquence de ladite protéine F consiste en la séquence de SEQ ID NO: 33 (séquence de la protéine F de l'isolât Gréer de PIV-2 présentée en Figure IB).

Ladite séquence susceptible de dériver de celle de la protéine F de PIV-2 peut ne pas comprendre de mutation autre que les mutations 24P, 133E, 294A5 439P ci-dessus mentionnées, par rapport à ladite séquence de protéine F de PIV-2. C'est par exemple le cas de la protéine mutante comprenant ou consistant en la séquence de SEQ ID NO: 90.

Alternativement, ladite séquence susceptible de dériver de celle de la protéine F de PIV-2 peut être susceptible de dériver de cette séquence de protéine F par lesdites mutations 24P, 133E, 294A, 439P ci-dessus mentionnées et par au moins une mutation autre que ces mutations 24P, 133E, 294A, 439P ci-dessus mentionnées, préférentiellement par : - au moins une mutation de pré-fusion choisie parmi :

- le remplacement de l'acide aminé en position 53 par l'acide aminé A,

- le remplacement de l'acide aminé en position 406 par l'acide aminé A,

- le remplacement de l'acide aminé en position 428 par l'acide aminé P,

- le remplacement de l'acide aminé en position 445 par l'acide aminé P, et/ou par

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe.

C'est par exemple le cas de la protéine mutante comprenant l'une des séquences de SEQ ID NO: 91 à 103 (ou consistant en l'une de ces séquences). De préférence, ladite séquence qui est susceptible de dériver de celle de ladite protéine F dérive de cette séquence de protéine F par lesdites mutations 24P, 133E, 294A, 439P ci- dessus mentionnées et par :

- au moins une mutation de pré-fusion choisie parmi : - le remplacement de l'acide aminé en position 53 par l'acide aminé A,

- le remplacement de l'acide aminé en position 406 par l'acide aminé A, et/ou par

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe.

C'est par exemple le cas de la protéine mutante comprenant l'une des séquences de SEQ ID NO: 91 à 103 (ou consistant en l'une de ces séquences).

Avantageusement, ledit acide aminé hydrophobe est choisi parmi V, I, L, préférentiellement V.

De préférence, ladite séquence qui est susceptible de dériver de celle de ladite protéine F dérive de cette séquence de protéine F par lesdites mutations 24P, 133E, 294A, 439P ci- dessus mentionnées et par :

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe, - le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe ; et

- au moins une autre mutation de post-fusion, à savoir le remplacement de l'acide aminé en position 474 par un acide aminé hydrophobe, de préférence V, I ou L, plus préférentiellement V.

C'est par exemple le cas de la protéine mutante comprenant l'une des séquences de SEQ ID NO: 92, 93, 98, 99, 10O5 103 (ou consistant en l'une de ces séquences). De préférence, ladite séquence qui est susceptible de dériver de celle de ladite protéine F dérive de cette séquence de protéine F par lesdites mutations 24P, 133E, 294A, 439P ci- dessus mentionnées et par au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe.

C'est par exemple le cas de la protéine mutante comprenant l'une des séquences de SEQ ID NO: 92, 93 et 94 à 103 (ou consistant en l'une de ces séquences).

De préférence, ladite séquence qui est susceptible de dériver de celle de ladite protéine F dérive de cette séquence de protéine F par lesdites mutations 24P, 133E, 294A, 439P ci- dessus mentionnées et par :

- au moins une mutation de pré-fusion choisie parmi : - le remplacement de l'acide aminé en position 53 par l'acide aminé A,

- le remplacement de l'acide aminé en position 406 par l'acide aminé A, et par

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe.

C'est par exemple le cas de la protéine mutante comprenant l'une des séquences de SEQ ID NO: 92, 93 (ou consistant en l'une de ces séquences).

De préférence, ladite séquence qui est susceptible de dériver de celle de ladite protéine F dérive de cette séquence de protéine F par lesdites mutations 24P, 133E, 294A, 439P ci- dessus mentionnées et par les deux mutations de post-fusion, c'est-à-dire par :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe.

C'est par exemple le cas de la protéine mutante comprenant l'une des séquences de SEQ ID NO: 92, 93, 97, 100, 102, 103 (ou consistant en l'une de ces séquences). La présente demande vise plus particulièrement les protéines mutantes de protéine F de PIV-2 qui correspondent à celles présentées en tableau 4 ci-dessus pour PIV-5, en tenant compte que, comme indiqué en Figure 2B :

- la mutation 49A de F PIV-5 correspond à la mutation 53A dans F PIV-2,

- la mutation 402A de F PIV-5 correspond à 406A dans F PIV-2,

- la mutation 147V de F PIV-5 correspond à 151 V dans F PFV-2,

- la mutation 158V de F PIV-5 correspond à 162V dans F PIV-2,

- la mutation 463V de F PIV-5 correspond à 474V dans F PIV-2.

Tableau 5 : sélection de protéines mutantes de l'invention (protéines mutantes de protéine F de PIV-2)

Les mutations indiquées dans le tableau 5 peuvent être introduites dans la protéine F de n'importe quel isolât PIV-2, c'est-à-dire de l'isolât Gréer ou d'un isolât variant. Elles peuvent donc plus particulièrement être introduites dans la séquence de protéine F de SEQ ID NO: 33 présentée en Figure IB (protéine F de Gréer ; SEQ ID NO: 90 à 103).

Site de clivage :

Conformément à la présente invention, une protéine mutante de l'invention peut comprendre une séquence qui est susceptible de dériver de celle de la protéine F d'un virus PIV-5 ou PIV-2 par : les mutations ci-dessus mentionnées, et en outre par substitution du site de clivage natif de ladite protéine F par un autre site de clivage enzymatique, et/ou par insertion dans ladite protéine F d'un site de clivage enzymatique autre que le site de clivage natif de cette protéine F, de préférence par substitution du site de clivage natif de ladite protéine F par un autre site de clivage enzymatique.

Le site de clivage d'une protéine F de PIV-5 ou PIV-2 est le site de clivage des deux sous- unités (Fl et F2) de cette protéine F ; cf. Figure 9 pour une illustration sur la protéine F de

PIV-5.

Dans la forme native de la protéine F de PIV-5 et PIV-2, ce site de clivage est un site clivé par des furines.

Dans la forme native de la protéine F de PIV-5, ce site de clivage consiste en la séquence RRRRR (SEQ ID NO: 23). Il se situe en positions 98 à 102 de la forme native de la protéine F de PIV-5 (cf. Figure IA ; cf. Figure 9). Un exemple de fragment de séquence de protéine F de PIV-5 comprenant le site de clivage natif (ou naturel) de la protéine F de

PIV-5 est : IGENLETIRNQLIPTRRRRRFAGVVIGL (SEQ ID NO: 24). Dans la forme native de la protéine F de PIV-2, le site de clivage consiste en la séquence KTRQKR (SEQ ID NO: 25). Il se situe en positions 101 à 106 de la forme native de la protéine F de PIV-2 {cf. Figure IB). Un exemple de fragment de séquence de protéine F de PIV-2 comprenant le site de clivage natif (ou naturel) de la protéine F de PIV-2 est LTPLIENLSKISTVTDTKTRQKRFAGVVVGLAALGVA (SEQ ID NO: 26).

De préférence, ledit site de clivage autre que le site de clivage natif est un site de clivage tissu-spécifique.

De préférence, ledit site de clivage autre que le site de clivage natif est un site de clivage pour une enzyme exprimée spécifiquement par un ou des tissus tumoraux, très préférentiellement un site de clivage pour une enzyme exprimée spécifiquement par un ou des tissus métastasiques.

Par exemple, ledit site de clivage autre que le site de clivage natif peut être un site de clivage pour une métallo-protéase, tel que le site de clivage pour la métallo-protéase matricielle 9 (MMP-9) ; cf. exemple 2 ci-dessous.

Un site de clivage pour la métallo-protéase matricielle 9 (MMP-9) peut comprendre ou consister en la séquence PXXHyS/T (SEQ ID NO: 27) avec X = n'importe quel acide aminé, et avec Hy = n'importe quel acide aminé hydrophobe (c'est-à-dire n'importe quel acide aminé parmi F, M, V, L, I).

Par exemple, un site de clivage pour la métallo-protéase matricielle 9 (MMP-9) peut comprendre ou consister en la séquence PRRIT (SEQ ID NO: 28) et/ou la séquence IGENLETIRNQLIPTPRRITFAGVVIGL (SEQ ID NO : 29).

Des exemples de protéines mutantes de l'invention comprenant un tel site de clivage (par substitution du site de clivage natif) comprennent les protéines mutantes dont la séquence susceptible de dériver de la protéine F (de PIV-5) est la séquence de SEQ ID NO: 88 ou 89 (Fus8M et Fus8.7M, respectivement ; cf. exemple 2 ci-dessous).

Acides nucléiques de l'invention : La présente demande est également relative à un acide nucléique, ADN ou ARN, qui code une protéine mutante selon l'invention (selon le code génétique universel et en tenant compte de la dégénérescence de ce code), et à un acide nucléique complémentaire d'un tel acide nucléique (acide nucléique de même longueur parfaitement complémentaire): De tels acides nucléiques dérivent de la séquence de SEQ ID NO: 30 (séquence codant la protéine F de PIV-5 native), ou d'une séquence alternative codant ladite séquence alternative « SEQ ID NO: 31 avec S en 443 », ou d'une séquence variante codant une protéine F variante, ou bien de la séquence de SEQ ID NO: 32 (séquence codant la protéine F de PIV-2 native) ou d'une séquence variante codant une protéine F variante.

Vecteurs de l'invention :

La présente demande est également relative à un vecteur d'acide nucléique, plus particulièrement à un vecteur de transfection, transduction ou transformation, comprenant au moins un acide nucléique selon l'invention.

Un tel vecteur peut avantageusement être un vecteur d'expression.

De préférence, il s'agit d'un vecteur permettant l'expression dudit au moins un acide nucléique dans une cellule animale (cellule animale non-humaine et/ou cellule humaine), plus préférentiellement :

- dans une cellule humaine, avantageusement dans une cellule humaine pathologique, plus particulièrement une cellule humaine tumorale, plus préférentiellement une cellule de mélanome métastasique, ou

- dans une cellule placentaire.

Un tel vecteur d'expression peut avantageusement être un vecteur adénoviral.

Ce vecteur adénoviral peut comprendre des éléments de régulation de l'expression dudit acide nucléique, préférentiellement un promoteur, permettant une expression dudit acide nucléique dans des cellules tumorales, de préférence dans des cellules métastasiques, plus préférentiellement dans des cellules de mélanome métastasiques.

De préférence, cette expression est spécifique. Avantageusement, cette expression est suffisamment spécifique pour permettre l'expression dudit acide nucléique dans lesdites cellules tumorales ou métastasiques, sans qu'il y ait pour autant expression significative dans des cellules non-tumorales (voire, non-métastasiques).

Avantageusement, un tel vecteur adénoviral est un vecteur adénoviral oncolytique.

Alternativement, un vecteur d'expression de l'invention peut être un vecteur adénoviral qui comprend des éléments de régulation de l'expression dudit acide nucléique, préférentiellement un promoteur, permettant une expression dudit acide nucléique dans des cellules placentaires, de préférence dans des cellules placentaires pathologiques qui présentent une insuffisance de fusogénicité. De préférence, cette expression est spécifique. Avantageusement, cette expression est suffisamment spécifique pour permettre l'expression dudit acide nucléique dans lesdites cellules placentaires, sans qu'il y ait pour autant expression significative dans des cellules non-placentaires .

Un vecteur de l'invention peut alternativement ou complémentairement être un vecteur permettant l'insertion dudit au moins un acide nucléique dans le génome d'une cellule animale (cellule animale non-humaine et/ou cellule humaine), plus préférentiellement d'une cellule humaine, avantageusement d'une cellule humaine pathologique, plus particulièrement d'une cellule humaine tumorale, préférentiellement une cellule humaine métastasique, plus préférentiellement dans des cellules de mélanome métastasiques. Un tel vecteur est plus particulièrement destiné à la thérapie génique des tumeurs, particulièrement des tumeurs métastasiques, plus particulièrement des mélanomes métastasiques. La présente demande est également relative à un vecteur qui comprend au moins un acide nucléique de l'invention, et qui permet l'insertion dudit au moins un acide nucléique dans le génome d'une cellule animale (cellule animale non-humaine et/ou cellule humaine), plus préférentiellement d'une cellule humaine, avantageusement d'une cellule placentaire, préférentiellement une cellule placentaire humaine. Un tel vecteur est plus particulièrement destiné à la thérapie génique des maladies ou états impliquant une déficience du développement placentaire.

Cellules de l'invention : La présente demande est également relative à une cellule, qui comprend au moins une protéine mutante selon l'invention, et/ou au moins un acide nucléique, ADN ou ARN selon l'invention, et/ou au moins un vecteur selon l'invention.

Une telle cellule peut être une cellule humaine ou une cellule animale non-humaine.

De préférence, une telle cellule est une cellule tumorale, préférentiellement une cellule métastasique, plus préférentiellement une cellule de mélanome métastasique. Une telle cellule trouve notamment des applications en tant que cellule à capacité fusogène capable d'induire la formation de syncytia, tel que ci-dessous décrit.

Alternativement, une cellule de l'invention peut être une cellule non-tumorale du système immunitaire humain ou animal non-humain, préférentiellement une cellule dendritique non-tumorale humaine ou animale non-humaine, ladite cellule exprimant à sa surface au moins une protéine mutante selon l'invention. Une telle cellule trouve notamment des applications en tant qu'agent capable d'induire la production d'inhibiteur de la fusion cellulaire, par exemple par immunisation active, tel que ci-dessous décrit.

Applications médicales (pro-fusion):

Une protéine mutante de l'invention, et/ou un acide nucléique, ADN ou ARN de l'invention, et/ou un vecteur de l'invention, et/ou une cellule de l'invention, peuvent être utilisés dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état qui implique la présence et/ou la prolifération de cellules pathologiques et/ou non favorables à l'état de santé de l'organisme, plus particulièrement dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état qui implique une insuffisance de fusogénicité cellulaire, préférentiellement dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état néoplasique, telle qu'une tumeur, une tumeur métastasique, avantageusement un mélanome métastasique. De telles maladies ou états peuvent être traités et/ou prévenus et/ou palliés par diminution ou suppression de ces cellules pathologiques et/ou non favorables.

Une protéine mutante de l'invention exprimée à la surface de telles cellules induira la fusion de ces cellules, et par suite la formation de syncytia, conduisant à la destruction (ou à tout le moins à la diminution du nombre) de ces cellules. Une protéine mutante de l'invention, et/ou un acide nucléique, ADN ou ARN de l'invention, et/ou un vecteur de l'invention, et/ou une cellule de l'invention, peuvent être utilisés dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état' qui implique une déficience du développement placentaire.

De telles maladies ou états peuvent être traités et/ou prévenus et/ou palliés par induction ou stimulation de la fusion cellulaire placentaire.

La présente demande est donc également relative à une composition pharmaceutique ou un médicament qui comprend au moins une protéine mutante de l'invention et/ou au moins un acide nucléique, ADN, ARN de l'invention, et/ou au moins un vecteur de l'invention et/ou une cellule de l'invention.

Une telle composition pharmaceutique ou un tel médicament peut notamment être destiné au traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état qui implique la présence et/ou la prolifération de cellules pathologiques et/ou non favorables à l'état de santé de l'organisme, telle que ci-dessus indiquée (par exemple, tumeur, tumeur métastasique, mélanome métastasique), ou au traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état qui implique une insuffisance de fusogénicité cellulaire (par exemple, déficience du développement placentaire). Une telle composition pharmaceutique ou un tel médicament peut en outre comprendre au moins un véhicule pharmaceutiquement et/ou physiologiquement acceptable.

Une protéine mutante de l'invention (ou un acide nucléique, ADN, ARN, ou un vecteur d'expression de l'invention), peut être utilisée pour être exprimée par une cellule humaine ou une cellule animale non-humaine, préférentiellement pour être exprimée à la surface d'une telle cellule.

Cette cellule peut être une cellule pathologique, préférentiellement une cellule tumorale, plus préférentiellement une cellule métastasique, plus préférentiellement une cellule de mélanome métastasique, ou peut être une cellule non-tumorale, par exemple une cellule saine.

Plus particulièrement, des cellules pathologiques qui ont été prélevées sur un patient humain ou sur un sujet animal non-humain malade, peuvent être traitées ex vivo (ou in vitro) par mise en contact avec au moins une protéine mutante de l'invention et/ou au moins un acide nucléique, ADN ou ARN de l'invention et/ou au moins un vecteur d'expression de l'invention de sorte à leur faire exprimer une protéine mutante de l'invention.

Alternativement ou complémentairement, des cellules non-pathologiques mais localisées à proximité des cellules pathologiques du patient ou sujet peuvent être prélevées pour' subir ce traitement.

Les cellules ainsi traitées ex vivo (ou in vitro) peuvent alors être destinées à être réadministrées audit patient ou sujet.

De telles cellules sont utiles pour le traitement et/ou la prévention et/ou la palliation de la pathologie dont est affecté ledit patient ou sujet, par exemple une tumeur, une tumeur métastasique, un mélanome métastasique.

Alternativement, cette cellule peut être une cellule placentaire, plus particulièrement une cellule placentaire souffrant d'une insuffisance de fusogénicité. Une fois traitée par expression d'une protéine mutante de l'invention à sa surface, une telle cellule peut être destinée au traitement et/ou la prévention et/ou la palliation d'une déficience du développement placentaire.

La présente demande est donc plus particulièrement relative à une protéine mutante selon l'invention, un acide nucléique, ADN ou ARN selon l'invention, un vecteur selon l'invention, une cellule selon l'invention, pour une utilisation dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état néoplasique, préférentiellement d'une tumeur plus préférentiellement d'une tumeur métastasique, très préférentiellement d'un mélanome métastasique.

La présente demande est également plus particulièrement relative à une protéine mutante selon l'invention, un acide nucléique, ADN ou ARN selon l'invention, un vecteur selon l'invention, une cellule selon l'invention, pour une utilisation dans le traitement et/ou la prévention et/ou la palliation d'une déficience du développement placentaire.

Inhibiteurs de fusion selon l'invention :

La présente demande est également relative à des produits qui ont la capacité de diminuer ou bloquer la fusion cellulaire. Ces produits sont des inhibiteurs d'une ou plusieurs des protéines mutantes de l'invention. De tels inhibiteurs peuvent être utilisés dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état qui implique un excès de fusogénicité cellulaire, pféférentiellement dans le traitement et/ou la prévention et/ou la palliation d'une infection à virus enveloppé (telle qu'une infection à VIH, Influenza, Parainfluenza, Rhabdovirus), d'une allergie, d'une maladie auto-immune, d'un rejet de greffe.

De préférence, un inhibiteur selon l'invention est :

- un anticorps dirigé contre une protéine mutante selon l'invention, ou un fragment Fab ou F(ab')2 d'un tel anticorps, ou

- un acide nucléique aptamère ou un peptide aptamère qui se lie spécifiquement à au moins une protéine mutante selon l'invention, ou à un acide nucléique, ADN, ARN selon l'invention, ou

- une cellule du système immunitaire recombinante, préférentiellement une cellule dendritique recombinante, qui exprime à sa surface au moins une protéine mutante selon l'invention, ou

- un acide nucléique anti-sens d'un acide nucléique selon l'invention, ou

- un petit ARN interférant (small interfering RNA ; siRNA) comprenant un ARN double- brin de 19 à 22 nucléotides, capable de se lier (de s'hybrider) à un acide nucléique selon l'invention.

La présente demande est donc également relative à une cellule non-tumorale du système immunitaire humain ou animal non-humain, préférentiellement une cellule dendritique humaine ou animale non-humaine, ladite cellule exprimant à sa surface au moins une protéine mutante selon l'invention, ainsi qu'à l'utilisation de cette cellule dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état qui implique un excès de fusogénicité cellulaire, préférentiellement dans le traitement et/ou la prévention et/ou la palliation d'une infection à virus enveloppé (telle qu'une infection à VIH, Influenza, Parainfluenza, Rhabdovirus), d'une allergie, d'une maladie auto-immune, d'un rejet de greffe.

La présente demande est également relative à un anticorps dirigé contre une protéine mutante selon l'invention, ou contre plusieurs des protéines mutantes de l'invention. De préférence, cet anticorps est un anticorps spécifique de ladite ou desdites protéines mutantes de l'invention. Avantageusement, cet anticorps est un anticorps monoclonal. Un inhibiteur de l'invention peut être un fragment conservateur d'un tel anticorps, tel qu'un fragment Fab ou F(ab')2.

Un tel anticorps ou' fragment d'anticorps peut être destiné à bloquer ou inhiber un mécanisme de fusion cellulaire, par exemple en administrant cet anticorps ou fragment d'anticorps à un patient ou sujet qui en a le besoin.

Alternativement, ou complémentairement, une protéine mutante de l'invention peut être destinée à être elle-même administrée audit patient ou sujet de sorte à induire une immunisation active contre cette protéine, c'est-à-dire de sorte à induire la production par ledit patient ou sujet d'anticorps anti-protéine mutante. Si nécessaire ou souhaité, un ou plusieurs adjuvants de vaccin peuvent être administrés de manière conjointe ou différée dans le temps avec cette ou ces protéines mutantes.

La présente demande est donc également relative à un vaccin thérapeutique et/ou préventif et/ou palliatif, qui comprend au moins une protéine mutante de l'invention à titre d'agent immunogène, et avantageusement au moins un adjuvant d'immunisation. Un tel vaccin peut être, destiné au traitement et/ou à la prévention et/ou à la palliation d'une maladie ou d'un état qui implique un excès de fusogénicité cellulaire, préférentiellement dans le traitement et/ou la prévention et/ou la palliation d'une infection à virus enveloppé (telle qu'une infection à VIH, Influenza, Parainfluenza, Rhabdovirus), d'une allergie, d'une maladie auto-immune, d'un rejet de greffe.

La présente demande est également relative à :

- un acide nucléique aptamère ou un peptide aptamère qui se lie spécifiquement à au moins une protéine mutante de l'invention, ou à un acide nucléique, ADN, ARN de l'invention,

- une cellule du système immunitaire recombinante, préférentiellement une cellule dendritique recombinante, qui exprime à sa surface au moins une protéine mutante de l'invention,

- un acide nucléique anti-sens d'un acide nucléique de l'invention, - un petit ARN interférant (smalî interfering RNA ; siRNA) comprenant un ARN double- brin de 19 à 22 nucléotides, capable de se lier (de s'hybrider) à un acide nucléique de l'invention, et avantageusement de bloquer ou inhiber la transcription de cet acide nucléique. De tels produits sont également des inhibiteurs de l'invention. Ils peuvent donc être destinés au traitement et/ou à la prévention et/ou à la palliation d'une maladie ou d'un état qui implique un excès de fusogénicité cellulaire, tel que ci-dessus indiqué. Ils sont plus particulièrement destinés au traitement et/ou à la prévention et/ou à la palliation d'une maladie ou d'un état qui implique au moins un gène expresseur ou hyper-expresseur de protéine F.

La présente demande est donc également relative à une composition pharmaceutique ou un médicament qui comprend au moins un inhibiteur de l'invention. Une telle composition pharmaceutique ou un tel médicament peut notamment être destiné au traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état qui implique un excès de fusogénicité cellulaire, tel que ci-dessus indiqué. Une telle composition pharmaceutique ou un tel médicament peut en outre comprendre au moins un véhicule pharmaceutiquement et/ou physiologiquement acceptable.

La présente demande est plus particulièrement relative à un inhibiteur selon l'invention, pour une utilisation dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état impliquant un excès de fusogénicité cellulaire, ladite maladie ou état étant une infection à virus enveloppé (préférentiellement une infection à VIH et/ou Influenza et/ou Parainfluenza et/ou Rhabdovirus), une allergie, une maladie auto-immune, un rejet de greffe.

La présente demande est plus particulièrement relative à une protéine mutante selon l'invention, pour une utilisation à titre d'agent immunogène dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état impliquant un excès de fusogénicité cellulaire, ladite maladie ou d'un état étant une infection à virus enveloppé (préférentiellement une infection à VIH et/ou Influenza et/ou Parainfluenza et/ou Rhabdovirus), une allergie, une maladie auto-immune, un rejet de greffe.

La présente demande est plus particulièrement relative à un vaccin ou composition vaccinale, plus particulièrement un vaccin ou composition vaccinale destiné au traitement et/ou à la prévention et/ou à la palliation d'une maladie ou d'un état impliquant un excès de fusogénicité cellulaire, ladite maladie ou état étant une infection à virus enveloppé (préférentiellement une infection à VIH et/ou Influenza et/ou Parainfluenza et/ou Rhabdσvirus), une allergie, une maladie auto-immune, un rejet de greffe. Un tel vaccin ou compo'sition vaccinale comprend au moins protéine mutante selon l'invention, et optionnellement au moins un adjuvant physiologiquement acceptable.

Applications diagnostiques et pronostiques :

La présente demande est également relative à une méthode, plus particulièrement une méthode in vitro, pour le diagnostic ou le pronostic d'une maladie ou d'un état impliquant : - une formation insuffisante de syncytia, telle qu'une tumeur, une tumeur métastasique, un mélanome métastasique ou une déficience du développement placentaire, ou au contraire une formation excessive de syncytia, telle qu'une infection à virus enveloppé

(préférentiellement une infection à VIH et/ou Influenza et/ou Parainfluenza et/ou Rhabdovirus), une allergie, une maladie auto-immune, un rejet de greffe.

La méthode de diagnostic ou pronostic de l'invention comprend la détection d'au moins une protéine mutante selon l'invention ou d'au moins un acide nucléique selon l'invention, par exemple dans un échantillon biologique tel qu'un échantillon biologique qui a été prélevé sur le patient ou sujet objet dudit diagnostic ou pronostic.

Cette détection peut par exemple être réalisée par séquençage des protéines ou acides nculéiques contenus dans ledit échantillon.

Cette détection peut par exemple être réalisée par détection de ladite au moins une protéine mutante de l'invention à l'aide d'un anticorps, d'un peptide aptamère, ou d'un oligonucléotide aptamère se liant à ladite au moins une protéine mutante, plus particulièrement à l'aide d'un anticorps, peptide aptamère, ou oligonucléotide aptamère de l'invention.

Cette détection peut par exemple être réalisée par détection dudit au moins un acide nucléique de l'invention à l'aide d'un acide nucléique, d'un peptide aptamère, ou d'un oligonucléotide aptamère se liant audit au moins un acide nucléique, plus particulièrement à l'aide d'un acide nucléique complémentaire d'un acide nucléique de l'invention, d'un peptide aptamère, ou d'un oligonucléotide aptamère de l'invention. La présente demande est également relative audit anticorps, peptide aptamère, oligonucléotide aptamère, acide nucléique complémentaire, pour leur utilisation dans une méthode de diagnostic ou pronostic d'une formation insuffisante, ou au contraire excessive de syncytia.

Applications biotechnologiques (criblage) :

La présente demande est également relative à une méthode, plus particulièrement une méthode in vitro, pour le criblage d'un composé capable de diminuer ou bloquer la formation de syncytia. La méthode de l'invention comprend la mise en contact d'un composé candidat avec des cellules exprimant au moins une protéine mutante selon l'invention, de sorte à déterminer si ce composé candidat diminue ou bloque la fusion desdites cellules (par exemple, en comparant le niveau de fusion atteint en présence dudit composé candidat à celui atteint en son absence). De tels composés sont des principes actifs candidats pour le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état impliquant un excès de fusogénicité cellulaire, telles que les infections à virus enveloppés, les allergies, les maladies auto- immunes, les rejets de greffe.

Applications biotechnologiques (myélome, hvbridome) :

La présente demande est également relative à une cellule tumorale, plus particulièrement myélome, comprenant au moins une protéine mutante selon l'invention, préférentiellement comprenant au moins une telle protéine mutante à sa surface, et/ou comprenant au moins un acide nucléique selon l'invention, et/ou comprenant au moins un vecteur selon l'invention, plus particulièrement un vecteur d'expression selon l'invention. Une telle cellule tumorale, plus particulièrement un tel myélome, peut être notamment utilisée dans la production d'un hybridome (par fusion de cette cellule tumorale avec un lymphocyte B), plus particulièrement dans la production d'un hybridome producteur d'anticorps.

La présente demande est également relative à un hybridome, plus particulièrement un hybridome producteur d'anticorps, qui comprend au moins une protéine mutante selon l'invention, et/ou au moins un acide nucléique selon l'invention, et/ou au moins un vecteur selon l'invention. Un tel hybridome peut notamment être produit par mise en contact d'au moins un lymphocyte B avec au moins une cellule tumorale, plus particulièrement myélome, comprenant au moins une protéine mutante selon l'invention, préférentiellement comprenant au moins Une telle protéine mutante à sa surface, et/ou comprenant au moins un acide nucléique selon l'invention, et/ou comprenant au moins un vecteur selon l'invention. Une telle cellule tumorale présente une capacité fusogénique intrinsèque : elle est donc capable de fusionner avec ledit au moins un lymphocyte B, sans mise en œuvre de polyéthylène glycol (PEG) ou de moyens d'électroporation ou d'aucun autre des moyens qui, dans l'art antérieur, sont classiquement utilisés pour induire la fusion d'une cellule tumorale à un lymphocyte B dans le but de produire un hybridome.

Applications biotechnologiques (cellules souches ou pro génitrices) :

La présente demande est également relative à une cellule souche ou progénitrice, comprenant au moins une protéine mutante selon l'invention, préférentiellement comprenant au moins une telle protéine mutante à sa surface, et/ou comprenant au moins un acide nucléique selon l'invention, et/ou comprenant au moins un vecteur selon l'invention, plus particulièrement un vecteur d'expression selon l'invention. Une telle cellule souche ou progénitrice présente une capacité fusogénique intrinsèque : elle est donc capable de former par fusion des syncytia.

Si cette cellule souche ou progénitrice présente en outre une capacité de différentiation en cellule musculaire, elle est alors capable de former une fibre musculaire (par fusion cellulaire et formation d'un syncytium). La présente demande est donc également relative à une telle cellule souche ou progénitrice pour son utilisation dans la production, par exemple dans la production in vitro, d'une fibre musculaire.

Cette production peut par exemple être réalisée en plaçant une pluralité desdites cellules souches ou progénitrices en contact entre elles sur, ou dans, un milieu de culture permettant la prolifération de cellules souches, ou le cas échéant progénitrices, de sorte à ce que la capacité fusogène desdites cellules souches ou progénitrices puisse s'y exercer, induisant ainsi la formation d'un syncytia, plus particulièrement d'une fibre musculaire. Des exemples de milieux de culture permettant la prolifération de cellules souches, ou le cas échéant progénitrices, et qui sont en outre appropriés à l'expression de leur éventuelle capacité à se différencier en cellule musculaire, plus particulièrement en fibre musculaire, sont connus de la personne du métier, par exemple le milieu MCDB. Des exemples de marqueurs cellulaires permettant d'observer la différentiation d'une cellule souche ou progénitrice en cellule musculaire, plus particulièrement en fibre musculaire, sont également connus de la personne du métier, par exemple CD56.

Dans la présente demande, le terme "comprenant", avec lequel "incluant" ou "contenant" est synonyme, est un terme ouvert, et n'exclut pas la présence d'un ou plusieurs élément(s), ingrédient(s) ou étape(s) de méthode additionnel(s) qui ne serait(seraient) pas explicitement indiqué(s), tandis que le terme "consistant" ou "constitué" est un terme fermé, qui exclut la présence de tout autre élément additionnel, étape, ou ingrédient qui ne serait pas explicitement exposé. Le terme "consistant essentiellement" ou " essentiellement constitué" est un terme partiellement ouvert, qui n'exclut pas la présence d'un ou plusieurs élément(s), ingrédient(s) ou étape(s) additionnel(s), dans la mesure où ce(s) élément(s), ingrédient(s) ou étape(s) additionnel(s) n'affecte(nt) pas matériellement les propriétés de base de l'invention.

Par conséquent, le terme "comprenant" (ou "comprend(comprennent)") inclut les termes "consistant", "constitué", aussi bien que les termes "consistant essentiellement" et " essentiellement constitué".

Le contenu des documents et références bibliographiques qui sont cités dans la présente demande est incorporé par référence.

Les exemples qui suivent sont donnés à titre purement illustratif, ils ne limitent l'invention en aucune façon.

EXEMPLES

EXEMPLE 1 : construction des mutants et mesure de leur fusogénicité

Matériels et méthodes :

Cellules et virus

La lignée cellulaire LLC-MK2 (lignée de cellules de rein de Macaca mulattd) est disponible auprès de V American Type Culture Collection (ATCC) sous le numéro CCL-7. La lignée cellulaire A549 (lignée de cellules de carcinome pulmonaire humain) est disponible auprès de l'ATCC sous le numéro CCL-185.

La lignée recombinante HuH7-Tat (lignée de cellules d'hépatome humain) est disponible par transduction de cellules de la lignée HuH-7 par HIV-I Tat. ' La lignée HuH-7 est disponible auprès de la Collection Japonaise des Bioressources de Recherches -Japanese Collection of Research Bioresour ces- sous la référence JCRB0403. La transduction de la lignée HuH-7 par HIV-Tat a été réalisée à l'aide du vecteur rétroviral LXSN-tat transduisant le plasmide Tat.

Les cellules LLC-MK2, A549 et HuH7-Tat ont été cultivées en milieu EMEM {Eagle's Minimum Essentiel Médium) ou DMEM (Dulbecco/Vogt Modified Eagles' essential minimal Médium) avec 5% de sérum de veau fœtal.

La souche PIV-5 WR a été obtenue auprès de l'ATCC (numéro ATCC VR-288), et a été cultivée sur des cellules LLC-MK2 comme décrit dans Terrier et al. 2008.

Extraction d' ARN, RT-PCR et clonage

L'ARN viral a été extrait du surnageant obtenu à partir d'une infection de cellules LLC- MK2 par PIV-5, à l'aide du kit Absolutely RNA® microprep kit (Stratagene, USA), en suivant les instructions données par le fournisseur. La transcription inverse a été réalisée à l'aide d'hexamères aléatoires pd(N)6 (Amersham Biosciences, GB) et d'une transcriptase inverse {Reverse Transcriptase ; RT) du virus de la myéloblastose aviaire (Avion Myeloblastosis Virus ; AMV) (transcriptase inverse AMV-RT disponible auprès de Pr oméga).

L'amplification de la séquence complète de F PIV-5 a été réalisée avec un couple d'amorces conçu à partir de la séquence nucléotidique de PIV-5 disponible dans les bases de données (numéro d'accès GenBank AB021962).

Le couple d'amorces utilisé était le suivant :

Amorce sens (SEQ ID NO: 1) : 5' TTGCGGCCGCATGGGTACTATAA 3'

Amorce antisens (SEQ ID NO: 2) :

5' CCGCTCGAGTTATGATAAACAAAATTCTCC 3' L'amplification a été réalisée selon le protocole suivant : 950C pendant 2 min, puis 39 cycles (95°C/30 s 55°C/1 min 72°C/3 min) et une élongation finale de 10 min à 72°C. L'ADN complémentaire de F PIV-5 a été clone dans le plasmide d'expression pcDNA3.1(+) au niveau des sites Notl et Xhol au niveau du site multiple de clonage (cf. Figure 4).

Les produits PCR et les plasmides ont été purifiés, respectivement par les kits Nucleospin® Extractll et Nucleospin® plasmid (Macherey Nagel, Germany), en suivant les instructions indiquées par le fournisseur.

L'ensemble des séquençages réalisés dans cette étude a été réalisé par MWG Biotech (Ebersberg, Germany).

Mutagenèse dirigée par amplification en chaîne par polymérase (PCR)

Les protéines mutantes de protéine F de PIV-5 ont été réalisées par mutation dirigée au sein du plasmide pcDNA3.1 codant la protéine de fusion F PIV-5. La(les) mutation(s) a(ont) été générées par PCR à l'aide d'amorces complémentaires, en suivant le protocole indiqué par le fournisseur (QuickChange® Site-Directed Mutagenesis System disponible auprès de Stratagene). La liste des amorces utilisées est donnée dans le tableau 2 ci- dessous. L'ensemble des plasmides a été contrôlé par séquençage.

La mutation 443P est théoriquement pré-existante dans la protéine F de l'isolât WR. Toutefois, dans l'échantillon de cet isolât que les inventeurs ont reçu de l'ATCC, cette mutation n'était en fait pas présente. Elle a donc dû être introduite par les inventeurs.

Transfection des cellules

Les cellules ont été transfectées par les plasmides à l'aide du réactif ExGen500 (Fermentas), en suivant les instructions indiquées par le fournisseur. Un à trois microgrammes d'ADN plasmidique ont été ajoutés sur les cellules (à 70 à 80% confluence) pour 48h. L'efficacité de la transfection a été estimée à l'aide d'un plasmide codant la protéine vert fluorescent (Green Fluorescence Protein ; GFP).

Immunofluorescence par microscopie confocale

Les cellules transfectés ont été fixées à l'aide de paraformaldéhyde (1% v/v) en tampon phosphate (Phosphate Buffer Saline ; PBS) puis lavées deux fois. Les tapis cellulaires ont été incubés en présence d'un anticorps monoclonal dirigé contre la protéine de fusion F

PΓV-5, en l'occurrence l'anticorps monoclonal Fia décrit dans Randall et al. 1987, dilué au 1/10 en PBS pendant 3h. L'anticorps monoclonal Fia a été obtenu par immunisation de souris contre un isolât de PIV-5 (en l'occurrence l'isolât LN), préparation des hybridomes et sélection des anticorps anti-F spécifiques.

Les tapis cellulaires ont ensuite été lavés et incubés avec un anticorps secondaire antisouris IgG-Alexa Fluor® 633 (Invitrogen) dilué au 1/200 en PBS pendant 30 minutes. Après rinçages, les cellules ont été incubées pendant 10 minutes avec du Dapi (4',6' Di Amidino-2-Phényl Indole) au 1/1000 mélangé ou non avec de Pagglutinine de germe de blé {Wheat Germ Agglutinin ; WGA) couplée à de l'Alexa Fluor® 488 (WGA- Alexa Fluor® disponible auprès de Invitrogen) au 1/200 en tampon phosphate (Phosphate Buffer Saline ; PBS). Les images ont été acquises à l'aide d'un microscope confocal TCS SP2 (Leica).

Cytométrie en flux

La cytométrie en flux a été réalisée comme précédemment décrit dans la littérature (Horvat et Lamb 1992). Des cellules A549 ont été transfectées par les plasmides codant les différents Fus et ont été déposées sur glace. Les tapis cellulaires ont été rincés par du tampon phosphate PBS (Phosphate Buffer Saline ; PBS) comportant 1% d'azide de sodium. Un anticorps monoclonal anti-protéine F de PIV-5 (en l'occurrence l'anticorps monoclonal Fia) a ensuite été ajouté sur les tapis (1/500 en tampon phosphate PBS à 1% en sérum de veau fœtal), et incubé 30 minutes à 4°C. Les tapis ont été ensuite rincés et incubés en présence d'un anticorps secondaire anti-souris couplé à PAlexa Fluor® 488 au 1/1000 (Invitrogen). Après rinçages, les cellules ont été décollées doucement à l'aide de 500μL de tampon phosphate PBS à 0,5mM en EDTA (acide éthylène-diamine- tétraacétique). Les cellules ont été transférées dans des tubes dédiés à la cytométrie en flux contenant 500μL d'une solution de paraformaldéhyde 1%. L'intensité de fluorescence de 5000 cellules a été mesurée sur un cytomètre en flux trieur de cellules (Fluorescence- activated cell sorting ; FACS), en l'occurrence sur le FACSVantage™ SEflow de Becton Dickinson.

Test de fusion semi-quantitatif (scores de fusion établis en fonction de la taille du syncytium et du nombre de noyaux) Les tapis transfectés par les différents plasmides d'expression Fus et observés en immunofluorescence ont permis une analyse semi-quantitative. Cette analyse a consisté à déterminer un score de fusion pour chacun des mutants suivant les critères suivants : - La fusion ou non (simples agglomérats), notée -/+ ;

La taille du syncytium, notée sur une échelle de 1 à 5 ; - Le nombre de noyaux, noté sur une échelle de 1 à 5.

Le score ainsi calculé est l'addition des deux notes ; la note maximale théorique est donc de 10 et correspond à un syncytium de taille maximale avec un nombre maximum de noyaux.

Test de fusion quantitatif (mesure de l'activité luciférase)

Afin de quantifier la fusion cellule-cellule, des cellules A549 « donneuses » (2,5 millions de cellules par puits de plaque à 6 puits) ont été co-transfectées avec 2μg de plasmide pcDNA3.1 codant les différentes protéines mutantes Fus ainsi que 50ng d'un plasmide exprimant la luciférase sous la dépendance de la longue répétition terminale du VIH-I (Long Terminal Repeat ; LTR) (Lavillette et al. 2007).

A titre de témoin négatif, des cellules ont été co-transfectées avec 2μg de plasmide pcDNA3.1 vide.

Douze heures après la transfection, les cellules « donneuses » ont été détachées à l'aide de tampon phosphate (PBS) à 0,5 mM en EDTA, et ont été comptées puis replacées dans de nouvelles plaques 6 puits (105 cellules/puits). Des cellules « indicatrices » HuH7-Tat (4.105 cellules/puits) ont été décollées à l'aide du tampon PBS-EDTA, puis rincées et ajoutées aux cellules « donneuses ».

L'activité luciférase a été mesurée à 72h de co-culture à l'aide d'un kit de mesure de l'activité luciférase, en l'occurrence le Luciférase Assay system (E1500) kit de Promega, en suivant les indications données par le fournisseur.

Résultats :

Des protéines mutantes construites et produites par les inventeurs sont présentées en tableau 3 ci-dessus.

Dans ce tableau 3, les inventeurs ont organisé les différentes mutations selon la fonction qu'ils leur ont attribuée, à savoir : implication dans la fonction d'autonomie vis-à-vis de HN : positions 22, 132 et 290 de la protéine F de PIV-5 ;

- implication dans la fonction de pré-fusion : positions 49, 402, 443, 447 et 449 de la protéine F de PIV-5 ;

- implication dans la fonction de post-fusion : positions 147, 158 et 463 de la protéine F de PIV-5. En figures 5 A, 5B, 5C et 5D, sont illustrées les positions des mutations du tableau 3. Des protéines mutantes ont ainsi été construites, produites et testées par les inventeurs.

La séquence de protéine F de PIV-5 qui a été mise en œuvre lors de la construction et la production de ces protéines mutantes était une séquence alternative de protéine F d' isolât WR. Cette séquence alternative était identique à la séquence de SEQ ID NO: 31 (séquence Genbank), à l'exception de l'acide aminé en position 443 qui était S et non P (séquence alternative « SEQ ID NO: 31 avec S en 443 »).

Les séquences de SEQ ID NO: 47 à 79 sont donc les séquences qui résultent du remplacement, au sein de ladite séquence alternative « SEQ ID NO: 31 avec S en 443 », des acides aminés indiqués pour chacune de ces séquences dans le tableau 3 ci-dessus.

Une illustration des observations qui ont été faites au microscope lors des tests de fusion semi-quantitatifs est présentée en Figure 6A.

Les scores obtenus à l'issue des tests de fusion semi-quantitatifs sont présentés en Figure 6B.

Les protéines mutantes Fus 6, Fus 6.1, Fus 6.2 et Fus 6.3 ont conduit à l'agglutination de nombreuses cellules, mais à aucune fusion cellulaire. Les protéines mutantes Fus 3.3, Fus 3.1, Fus2, Fus 1.1, Fus 1.2 et Fus 1 donnent un score de fusion nul.

Les protéines mutantes Fus9, Fus7, Fus 3, Fus5 et Fus4 donnent de faibles scores de fusion.

Au-delà du score de fusion de Fus4, se détachent un ensemble de protéines mutantes à score de fusion significatif, à savoir :

- le groupe des protéines mutantes qui ont en commun de comprendre les trois mutations d'autonomie et la mutation de pré-fusion 449P, telles que les protéines mutantes Fus8, FuslO, FuslO.4, Fusl0.5, Fusi l, FusS.l, Fus8.2, Fus8.4, Fus8.5, Fus8.6, Fus8.7, FuslO.l, FuslO.2, Fusl0.3, et le groupe des protéines mutantes qui ont en commun de comprendre les trois mutations d'autonomie, la mutation de pré-fusion 447P et au moins une mutation de post-fusion (147V ou 158V), telles que Fus7.1, Fus7.2 et Fus7.3.

Les Figures 7A et 7B présentent une illustration des observations faites au microscope et présentent les scores de fusion pour une sélection des protéines mutantes testées, à savoir le groupe des protéines mutantes qui ont en commun de comprendre les trois mutations d'autonomie et la mutation de pré-fusion 449P, telles que les protéines mutantes Fus8, FuslO, Fusl0.4, Fusl0.5, Fusi l, Fus8.1, Fus8.2, Fus8.4, Fus8.5, Fus8.6, Fus8.7, Fusl0.1, Fusl0.2, Fusl0.3.

Les Figures 8 A, 8B et 8 C donnent une illustration des résultats des résultats obtenus par le test de fusion dit quantitatif (test par luciférase).

Les Figures 8A et 8C montrent que les protéines mutantes qui ont en commun de comprendre les trois mutations d'autonomie et la mutation de pré-fusion 449P, telles que la protéine mutante Fus8, présentent une capacité fusogène plus forte (en fait, plus de trois fois plus forte) que celle de la protéine Fus3, même lorsque Fus3 est associée à la glycoprotéine HN, à titre de mimétique de la situation naturelle (Figure 8A).

La protéine mutante Fus8.7 présente une capacité fusogène plus forte que la protéine mutante Fus8 (presque deux fois plus importante), elle même plus forte que la protéine

Fus3 (plus de six fois plus importante) même lorsque Fus3 est associé à la glycoprotéine

HN, à titre de mimétique de la situation naturelle (Figure 8C).

La Figure 8B illustre le fait que la capacité fusogénique du groupe des protéines mutantes qui ont en commun de comprendre les trois mutations d'autonomie et la mutation de préfusion 449P3 n'est pas due à une simple corrélation avec le niveau d'expression surfacique obtenu. En effet, on peut notamment constater que l'expression de Fus 8 est environ moitié moindre que celle de Fus3 (Figure 8B).

EXEMPLE 2 : Substitution du site de clivage naturel par Ie site d'une enzyme exprimée spécifiquement par le tissu tumoral métastatique Les protéines mutantes de l'invention, et plus particulièrement celles décrites en exemple 1 ci-dessus, ont été plus avant modifiées par substitution du site de clivage naturel de la protéine F native, par exemple pour le remplacer par un site de clivage tissu-spécifique.

A titre illustratif, sont ici présentées des protéines mutantes de l'invention dont le site de clivage naturel a été substitué par le site d'une enzyme exprimée spécifiquement par le tissu tumoral métastatique, à savoir la métallo-protéase matricielle 9 (MMP-9).

La Figure 9 illustre la substitution ainsi opérée pour des protéines mutantes de la protéine F de PIV-5.

Le site de clivage naturel de la protéine F de PIV-5 est : RRRRR (SEQ ID NO: 23).

Un exemple de fragment de séquence de protéine F comprenant le site de clivage naturel de la protéine F de PIV-5 est : IGENLETIRNQLIPTRRRRRFAGVVIGL (SEQ ID NO: 24).

La séquence consensus d'un site de clivage MMP-9 est : PXXHyS/T (SEQ ID NO: 27) avec X = n'importe quel acide aminé, et avec Hy = n'importe quel acide aminé hydrophobe (c'est-à-dire n'importe quel acide aminé parmi F, M, V, L, I).

Un exemple de site de clivage MMP-9 est : PRRIT (SEQ ID NO: 28).

Un exemple de fragment de séquence de protéine F mutante de l'invention comprenant un site de clivage MMP-9 est : IGENLETIRNQLIPTPRRITFAGVVIGL (SEQ ID NO: 29).

Matériels et Méthodes : Les protéines mutantes de la protéine F de PIV-5 ont été produites comme décrit en exemple 1 ci-dessus.

Le remplacement du site de clivage naturel par le site de clivage sélectionné, en l'occurrence, le site de clivage MMP-9 de SEQ ID NO : 28, a été réalisé comme suit :

Le remplacement du site de clivage a été réalisé par 3 mutagenèses dirigées successives au sein du plasmide pcDNA3.1 codant la protéine de fusion F PIV-5. Les mutations ont été générées par PCR à l'aide d'amorces complémentaires, en suivant le protocole indiqué par le fournisseur (QuickChange® Site-Directed Mutagenesis System disponible auprès de Stratagene). L'ensemble des plasmides a été contrôlé par séquençage.

1ÈRE MUTATION R98P

SENS 5' CCAGTTGATTCCAACTCCGAGGAGACGCCGGTTTGC 3' (SEQ ID

NO: 80) ANTISENS 5' GCAAACCGGCGTCTCCTCGGAGTTGGAATCAACTGG S' (SEQ ID NO: 81)

2NDE MUTATION RlOlI

SENS 5 ' GATTCCAACTCCGAGGAGAATCCGGTTTGCAGGAGTGGTG 3 ' (SEQ ID NO: 82)

ANTISENS 5'CACCACTCCTGCAAACCGGATTCTCCTCGGAGTTGGAATC 3' (SEQ ID NO: 83)

3 ÈME MUTATIQN R1Q2T SENS

5' GATTCCAACTCCGAGGAGAATCACGTTTGCAGGAGTGGTGATTGG 3'

(SEQ ID NO: 84)

ANTISENS

5' CCAATCACCACTCCTGCAAACGTGATTCTCCTCGGAGTTGGAATC 3' (SEQ ID NO: 85)

Transfection des cellules

Les cellules ont été transfectées par les plasmides à l'aide du réactif ExGen500

(Fermentas), en suivant les instructions indiquées par le fournisseur. Un à trois microgrammes d'ADN plasmidique ont été ajoutés sur les cellules (à 70 à 80% confluence) pour 48h. L'efficacité de la transfection a été estimée à l'aide d'un plasmide codant la protéine vert fluorescent {Green Fluorescence Protein ; GFP).

Immunofluorescence par microscopie confocale

Les cellules transfectés ont été fixées à l'aide de paraformaldéhyde (1% v/v) en tampon phosphate {Phosphate Buffer Saline ; PBS) puis lavées deux fois. Les tapis cellulaires ont été incubés en présence d'un anticorps monoclonal dirigé contre la protéine de fusion F PIV-5, en l'occurrence l'anticorps monoclonal Fia décrit dans Randall et al. 1987, dilué au 1/10 en PBS pendant 3h. L'anticorps monoclonal Fia a été obtenu par immunisation de souris contre un isolât de PIV-5 (en l'occurrence l'isolât LN), préparation des hybridomes et sélection des anticorps anti-F spécifiques.

Les tapis cellulaires ont ensuite été lavés et incubés avec un anticorps secondaire antisouris IgG-Alexa Fluor® 633 (Invitrogen) dilué au 1/200 en PBS pendant 30 minutes. Après rinçages, les cellules ont été incubées pendant 10 minutes avec du Dapi (4',6' Di Amidino-2-Phényl Indole) au 1/1000 mélangé ou non avec de Pagglutinine de germe de blé (Wheat Germ Agglutinin ; WGA) couplée à de l'Alexa Fluor® 488 (WGA- Alexa Fluor® disponible auprès de Invitrogen) au 1/200 en tampon phosphate {Phosphate Buffer Saline ; PBS). Les images ont été acquises à l'aide d'un microscope confocal TCS SP2 (Leica).

Résultats :

Les inventeurs ont ainsi obtenu des protéines mutantes telles que les protéines Fus8M et Fus8.7M (SEQ ID NO: 88 et 89, respectivement) qui dérivent des protéines mutantes Fus8 et Fus8.7 par remplacement du site de clivage naturel par le site MMP-9 de SEQ ID NO: 28.

Fus8 (SEQ ID NO: 65) :

Le site de clivage naturel est en positions 98 à 102 (RRRRR).

FusSM (SEQ ID NO: 88) :

Le site de clivage naturel RRRRR a été remplacé par le site PRRIT (site de MMP-9).

Fus8.7 (SEQ ID NO: 76) :

Le site de clivage naturel est en positions 98 à 102 (RRRRR). Fus8.7M (SEQ ID NO: 89) :

Le site de clivage naturel RRRRR a été remplacé par le site PRRIT (site de MMP-9).

Les protéines mutantes obtenues sont aussi fonctionnelles que les protéines mutantes à site de clivage naturel dont elles dérivent (induction de syncytia larges comprenant de nombreux noyaux, expression de surface et quantification d'un haut niveau de fusogénicité).

Ce résultat est illustré par la figure 9 (immunofluorescence par microscopie confocale réalisée comme décrit en exemple 1).

La modification du site de clivage ne semble pas modifier de manière significative la capacité fusogène (scores de fusion très proches) et la fonctionnalité des protéines mutantes de l'invention.

Pour ce qui concerne les protéines mutantes de l'invention qui dérivent de la protéine F de PIV-2, la même opération d'introduction ou substitution de site de clivage peut être réalisée.

Le site de clivage naturel de la protéine F de PIV-2 est KTRQKR (SEQ ID NO: 25), un exemple de fragment de séquence de protéine F comprenant le site de clivage naturel de la protéine F de PIV-2 étant LTPLIENLSKISTVTDTKTRQKRFAGVVVGLAALGVA (SEQ ID NO: 26). Dans les protéines mutantes de l'invention, un site de clivage autre que ce site naturel de clivage peut être introduit ou venir en substitution, par exemple un site de clivage tissu-spécifique, plus particulièrement un site de clivage d'une enzyme exprimée spécifiquement par le tissu tumoral métastatique, telle que la métallo-protéase matricielle 9 (MMP-9 ; site de SEQ ID NO: 27 ou 28 par exemple).

Références bibliographiques

Baker ét al. 1999, Mol CeIl. 3(3):309-19. Chatziandreou et al. 2004, Journal of General Virology 85 : 3007-3016.

Horvat et Lamb 1992, J. Virol. 66(4) : 2443-2455.

Ito ét al. 1997, J Virol. 71(12) : 9855-9858.

Ito et al. 2000, J Gen Virol. 81(Pt 3):719-727.

Gardner et Dutch 2007, J. Virol. 81(15):8303-14. Gardner et al. 2007, Biochemistry 46(17):5094-5105.

Lavillette D. ét al. 2007, J. Virol. 81(16) : 8752-8765

Paterson et al. 2000, Virology 270(1): 17-30.

Randall ét al. 1987, J . Gen. Virol. 68(PtI l) : 2769-2780

Russell et al. 2003, J. CeIl Biol. 163(2):363-74. Terrier et al. 2008, Journal of Clinical Virology, 2008, 43(1): 86-92.

West et al. 2005, J Virol. 79(3):1543-1551.

REVENDICATIONS

1. Protéine mutante, dont la séquence en acides aminés comprend une séquence qui est susceptible de dériver de celle de la protéine F d'un virus PIV-5 ou PIV-2 :

- par remplacement :

- de l'acide aminé qui, dans la séquence de ladite protéine F de virus PIV-5, est en position 22, ou qui, dans la séquence de ladite protéine F de virus PIV-2, est en position 24, par l'acide aminé P, et - de l'acide aminé qui, dans la séquence de ladite protéine F de virus PIV-5, est en position 132, ou qui, dans la séquence de ladite protéine F de virus PIV-2, est en position 133, par l'acide aminé E, et

- de l'acide aminé qui, dans la séquence de ladite protéine F de virus PIV-5, est en position 290, ou qui, dans la séquence de ladite protéine F de virus PIV-2, est en position 294, par l'acide aminé A, et

- de l'acide aminé qui, dans la séquence de ladite protéine F de virus PIV-5, est en position 449, ou qui, dans la séquence de ladite protéine F de virus PIV-2, est en position 439, par l'acide aminé P,

- et, optionnellement : - par substitution du site de clivage natif de ladite protéine F par un autre site de clivage enzymatique, et/ou par insertion dans ladite protéine F d'un site de clivage enzymatique autre que le site de clivage natif de cette protéine F, et/ou

- par délétion d'une partie C-terminale de ladite protéine F, ladite partie C- terminale s 'étendant en direction N-terminale à partir du dernier acide aminé à l'extrémité C-terminale de la protéine, mais sans s'étendre au-delà du domaine

HR2 de ladite protéine F.

2. La protéine mutante selon la revendication 1, caractérisée en ce que la séquence de ladite protéine F de virus PIV-5 ou PIV-2 comprend la séquence de SEQ ID NO: 34.

3. La protéine mutante selon la revendication 1 ou 2, caractérisée en ce que la séquence de ladite protéine F est une protéine F de PIV-5.

4. La protéine mutante selon la revendication 3, caractérisée en ce que la séquence de ladite protéine F consiste en :

- la séquence de SEQ ID NO: 31, ou la séquence alternative qui est identique à la séquence de SEQ ID NO: 31 à l'exception de l'acide aminé en position 443, qui est S dans cette séquence alternative (au lieu de P en SEQ ID NO: 31), ou en

- une séquence variante de cette séquence de SEQ ID NO: 31 ou de ladite séquence alternative, cette séquence variante : o étant d'une taille identique à celle de SEQ ID NO: 31, ou étant d'une taille supérieure d'un maximum de 7 acides aminés à celle de SEQ ID NO: 31, ou étant d'une taille inférieure d'un maximum de 7 acides aminés à celle de

SEQ ID NO: 31, et o présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 31 ou à ladite séquence alternative, cette identité étant calculée sur la longueur de la séquence de SEQ ID NO: 31 ou, le cas échéant, de ladite séquence alternative.

5. La protéine mutante selon la revendication 4, caractérisée en que ladite protéine F consiste en l'une des séquences de SEQ ID NO: 35 à 46.

6. La protéine mutante selon l'une quelconque des revendications 3 à 5, caractérisée en que sa séquence en acides aminés ne comprend pas d'autre mutation par rapport à ladite séquence de protéine F de PIV-5.

7. La protéine mutante selon la revendication 6, caractérisée en que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est la séquence de SEQ ID NO: 65.

8. La protéine mutante selon l'une quelconque des revendications 3 à 5, caractérisée en que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver cette séquence de protéine F par : - au moins une mutation de pré-fusion choisie parmi :

- le remplacement de l'acide aminé en position 49 par l'acide aminé A,

- le remplacement de l'acide aminé en position 402 par l'acide aminé A,

- le remplacement de l'acide aminé en position 443 par l'acide aminé P, - le remplacement de l'acide aminé en position 447 par l'acide aminé P, et/ou par

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe.

9. La protéine mutante selon l'une quelconque des revendications 3 à 5 et 8, caractérisée en ce que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver de cette séquence de protéine F par :

- au moins une mutation de pré-fusion choisie parmi :

- le remplacement de l'acide aminé en position 49 par l'acide aminé A5

- le remplacement de l'acide aminé en position 402 par l'acide aminé A, et/ou par

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe.

10. La protéine mutante selon la revendication 8 ou 9, caractérisée en ce que ledit acide aminé hydrophobe est choisi parmi V, I, L, préférentiellement V.

11. La protéine mutante selon l'une quelconque des revendications 3 à 5 et 8 à 10, caractérisée en ce que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver cette séquence de protéine F par :

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe ; et - au moins une autre mutation de post-fusion, à savoir le remplacement de l'acide aminé en position 463 par un acide aminé hydrophobe, de préférence V, I ou L, plus préférentiellement V.

12. La protéine mutante selon l'une quelconque des revendications 3 à 5 et 8 à ll, caractérisée en que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est une séquence choisie parmi les séquences de SEQ ID NO: 61 h 19.

13. La protéine mutante selon l'une quelconque des revendications 3 à 5 et 8 à 12, caractérisée en que ladite séquence qui est susceptible de dériver de celle de ladite protéine

F est en outre susceptible de dériver de cette séquence de protéine F par au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe, - le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe.

14. La protéine mutante selon la revendication 13, caractérisée en ce que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est une séquence choisie parmi les séquences de SEQ ID NO: 68 à 79.

15. La protéine mutante selon l'une quelconque des revendications 3 à 5 et 8 à 11, caractérisée en que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver de cette séquence de protéine F par : - au moins une mutation de pré-fusion choisie parmi :

- le remplacement de l'acide aminé en position 49 par l'acide aminé A3

- le remplacement de l'acide aminé en position 402 par l'acide aminé A, et par

- au moins une mutation de post-fusion choisie parmi : - le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe.

16. La protéine mutante selon la revendication 15, caractérisée en ce que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est une séquence choisie parmi les séquences de SEQ ID NO: 68, 69, 70.

17. La protéine mutante selon l'une quelconque des revendications 3 à 5 et 8 à 11, caractérisée en que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver de cette séquence de protéine F par :

- le remplacement de l'acide aminé en position 147 par un acide aminé hydrophobe, - le remplacement de l'acide aminé en position 158 par un acide aminé hydrophobe.

18. La protéine mutante selon la revendication 17, caractérisée en ce que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est une séquence choisie parmi les séquences de SEQ ID NO: 76, 78.

19. La protéine mutante selon la revendication 1 ou 2, caractérisée en ce que la séquence de ladite protéine F est une protéine F de PIV-2.

20. La protéine mutante selon la revendication 19, caractérisée en ce que la séquence de ladite protéine F consiste en :

- la séquence de SEQ ID NO: 33, ou en

- une séquence variante de cette séquence de SEQ ID NO: 33, cette séquence variante : o étant d'une taille identique à celle de SEQ ID NO: 33, ou étant d'une taille supérieure d'un maximum de 2 acides aminés à celle de SEQ ID NO: 33, ou étant d'une taille inférieure d'un maximum de 2 acides aminés à celle de

SEQ ID NO: 33, et o présentant une identité de séquence de plus de 95%, préférentiellement d'au moins 96%, plus préférentiellement d'au moins 97%, par rapport à la séquence de SEQ ID NO: 33, cette identité étant calculée sur la longueur de la séquence de SEQ ID NO: 33.

21. La protéine mutante selon la revendication 19 ou 20, ladite séquence qui est susceptible de dériver de celle de ladite protéine F est une séquence choisie parmi les séquences de SEQ ID NO: 90 à 103.

22. La protéine mutante selon la revendication 19 ou 20, caractérisée en que sa séquence en acides aminés ne comprend pas d'autre mutation par rapport à ladite séquence de protéine F de PIV-2.

23. La protéine mutante selon la revendication 19 ou 20, caractérisée en que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver cette séquence de protéine F par :

- au moins une mutation de pré-fusion choisie parmi :

- le remplacement de l'acide aminé en position 53 par l'acide aminé A,

- le remplacement de l'acide aminé en position 406 par l'acide aminé A, - le remplacement de l'acide aminé en position 428 par l'acide aminé P,

- le remplacement de l'acide aminé en position 445 par l'acide aminé P, et/ou par

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe.

24. La protéine mutante selon l'une quelconque des revendications 19, 20, 23, caractérisée en ce que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver de cette séquence de protéine F par :

- au moins une mutation de pré-fusion choisie parmi :

- le remplacement de l'acide aminé en position 53 par l'acide aminé A,

- le remplacement de l'acide aminé en position 406 par l'acide aminé A, et/ou par

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe, - le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe.

25. La protéine mutante selon la revendication 23 ou 24, caractérisée en ce que ledit acide aminé hydrophobe est choisi parmi V, I, L, préférentiellement V.

26. La protéine mutante selon l'une quelconque des revendications 19, 20 et 23 à 25, caractérisée en ce que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver cette séquence de protéine F par : - au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe ; et

- au moins une autre mutation de post-fusion, à sayoir le remplacement de l'acide aminé en position 474 par un acide aminé hydrophobe, de préférence V, I ou L, plus préférentiellement V.

27. La protéine mutante selon l'une quelconque des revendications 19, 20 et 23 à 26, caractérisée en que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver de cette séquence de protéine F par au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe.

28. La protéine mutante selon l'une quelconque des revendications 19, 20 et 23 à 27, caractérisée en que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver de cette séquence de protéine F par :

- au moins une mutation de pré-fusion choisie parmi :

- le remplacement de l'acide aminé en position 53 par l'acide aminé A,

- le remplacement de l'acide aminé en position 406 par l'acide aminé A, et par

- au moins une mutation de post-fusion choisie parmi :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe, - le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe.

29. La protéine mutante selon l'une quelconque des revendications 19, 20 et 23 à 28, caractérisée en que ladite séquence qui est susceptible de dériver de celle de ladite protéine F est en outre susceptible de dériver de cette séquence de protéine F par :

- le remplacement de l'acide aminé en position 151 par un acide aminé hydrophobe,

- le remplacement de l'acide aminé en position 162 par un acide aminé hydrophobe.

30. La protéine mutante selon l'une quelconque des revendications 1 à 29, caractérisée en qu'elle comprend une séquence qui est susceptible de dériver de celle de la protéine F d'un virus PIV-5 ou PIV-2 par substitution du site de clivage natif de ladite protéine F par un autre site de clivage enzymatique, et/ou par insertion dans ladite protéine F d'un site de clivage enzymatique autre que le site de clivage natif de cette protéine F.

31. La protéine mutante selon la revendication 30, caractérisée en ce que ledit site de clivage autre que le site de clivage natif est un site de clivage tissu-spécifique.

32. La protéine mutante selon la revendication 30 ou 31, caractérisée en ce que ledit site de clivage autre que le site de clivage natif est un site de clivage pour une enzyme exprimée spécifiquement par un ou des tissus tumoraux.

33. La protéine mutante selon l'une quelconque des revendications 30 à 32, caractérisée en ce que ledit site de clivage autre que le site de clivage natif est un site de clivage pour une enzyme exprimée spécifiquement par un ou des tissus métastasiques.

34. La protéine mutante selon l'une quelconque des revendications 30 à 33, caractérisée en ce que ledit site de clivage autre que le site de clivage natif est un site de clivage pour une métallo-protéase .

35. La protéine mutante selon l'une quelconque des revendications 30 à 34, caractérisée en ce que ledit site de clivage autre que le site de clivage natif est un site de clivage pour la métallo-protéase matricielle 9 (MMP-9).

36. La protéine mutante selon l'une quelconque des revendications 30 à 35, caractérisée en ce que ledit site de clivage autre que le site de clivage natif comprend la séquence

PXXHyS/T (SEQ ID NO: 27) avec X = n'importe quel acide aminé, et avec Hy = n'importe quel acide aminé parmi F, M, V, L, I.

37. La protéine mutante selon l'une quelconque des revendications 30 à 36, caractérisée en ce que ledit site de clivage autre que le site de clivage natif comprend la séquence PREIT

(SEQ ID NO: 28) et/ou la séquence IGENLETIRNQLIPTPRRITF AGVVIGL (SEQ ID NO: 29).

38. La protéine mutante selon l'une quelconque des revendications 30 à 37, caractérisée en ce qu'elle comprend la séquence de SEQ ID NO: 88 ou 89.

39. Acide nucléique, ADN ou ARN, qui code une protéine mutante selon l'une quelconque des revendications 1 à 38, ou acide nucléique complémentaire d'un tel acide nucléique.

40. Vecteur de transfection, transduction ou transformation, comprenant au moins un acide nucléique selon la revendication 39.

41. Le vecteur de la revendication 40, caractérisé en ce qu'il est un vecteur d'expression.

42. Le vecteur d'expression selon la revendication 41, caractérisé en ce qu'il est un vecteur adénoviral.

43. Le vecteur d'expression selon la revendication 41 ou 42, caractérisé en qu'il est un vecteur adénoviral qui comprend des éléments de régulation de l'expression dudit acide nucléique permettant une expression dudit acide nucléique dans des cellules tumorales, de préférence dans des cellules métastasiques, plus préférentiellement dans des cellules de mélanome métastasiques.

44. Le vecteur d'expression selon l'une quelconque des revendications 41 à 43, caractérisé en ce qu'il est un vecteur adénoviral oncolytique.

45. Le vecteur de la revendication 40, caractérisé en ce qu'il est un vecteur permettant l'insertion dudit au moins un acide nucléique dans le génome d'une cellule animale, préférentiellement d'une cellule humaine, plus particulièrement d'une cellule humaine tumorale, préférentiellement une cellule humaine métastasique, plus préférentiellement dans des cellules de mélanome métastasiques.

46. Cellule, caractérisée en ce qu'elle comprend au moins une protéine mutante selon l'une quelconque des revendications 1 à 38, et/ou au moins un acide nucléique, ADN ou ARN selon la revendication 39, et/ou au moins un vecteur selon l'une quelconque des revendications 40 à 45.

47. La cellule selon la revendication 46, caractérisée en ce qu'elle est une cellule humaine ou une cellule animale non-humaine.

48. La cellule selon la revendication 46 ou 47, caractérisée en ce qu'elle est une cellule tumorale, préférentiellement une cellule métastasique, plus préférentiellement une cellule de mélanome métastasique.

49. Une protéine mutante selon l'une quelconque des revendications 1 à 38, un acide nucléique, ADN ou ARN selon la revendication 39, un vecteur selon l'une quelconque des revendications 40 à 45, une cellule selon l'une quelconque des revendications 46 à 48, pour une utilisation dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état néoplasique, préférentiellement d'une tumeur métastasique, préférentiellement d'un mélanome métastasique.

50. Une protéine mutante selon l'une quelconque des revendications 1 à 38, un acide nucléique, ADN ou ARN selon la revendication 39, un vecteur selon l'une quelconque des revendications 40 à 45, une cellule selon l'une quelconque des revendications 46 à 48, pour une utilisation dans le traitement et/ou la prévention et/ou la palliation d'une déficience du développement placentaire.

51. Inhibiteur de la fusion cellulaire, caractérisé en ce qu'il est :

- un anticorps dirigé contre une protéine mutante selon l'une quelconque des revendications 1 à 38, ou un fragment Fab ou F(ab')2 d'un tel anticorps, - un acide nucléique aptamère ou un peptide aptamère qui se lie spécifiquement à au moins une protéine mutante selon l'une quelconque des revendications 1 à 38, ou à un acide nucléique, ADN, ARN selon la revendication 39,

- une cellule du système immunitaire recombinante, préférentiellement une cellule dendritique recombinante, qui exprime à sa surface au moins une protéine mutante selon l'une quelconque des revendications 1 à 38,

- un acide nucléique anti-sens d'un acide nucléique selon la revendication 39,

- un petit ARN interférant {small interfering RNA ; siRNA) comprenant un ARN double- brin de 19 à 22 nucléotides, capable de se lier à un acide nucléique selon la revendication 39.

52. La cellule de la revendication 46, qui est une cellule du système immunitaire humain ou animal non-humain, préférentiellement une cellule dendritique humaine ou animale non-humaine, ladite cellule exprimant à sa surface au moins une protéine mutante selon l'une quelconque des revendications 1 à 38.

53. L'inhibiteur de fusion cellulaire de la revendication 51, pour une utilisation dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état impliquant un excès de fusogénicité cellulaire, ladite maladie ou état étant une infection à virus enveloppé (préférentiellement une infection à VIH et/ou Influenza et/ou Parainfluenza et/ou Rhabdovirus), une allergie, une maladie auto-immune, un rejet de greffe.

54. Une protéine mutante selon l'une quelconque des revendications 1 à 38, pour une utilisation à titre d'agent immunogène dans le traitement et/ou la prévention et/ou la palliation d'une maladie ou d'un état impliquant un excès de fusogénicité cellulaire, ladite maladie ou d'un état étant une infection à virus enveloppé (préférentiellement une infection à VIH et/ou Influenza et/ou Parainfluenza et/ou Rhabdovirus), une allergie, une maladie auto-immune, un rejet de greffe.

55. Vaccin destiné au traitement et/ou à la prévention et/ou à la palliation d'une maladie ou d'un état impliquant un excès de fusogénicité cellulaire, ladite maladie ou état étant une infection à virus enveloppé (préférentiellement une infection à VIH et/ou Influenza et/ou Parainfluenza et/ou Rhabdovirus), une allergie, une maladie auto-immune, un rejet de greffe, caractérisé en ce qu'il comprend au moins protéine mutante selon l'une quelconque des revendications 1 à 38.

56. Méthode in vitro pour le diagnostic ou le pronostic d'une maladie impliquant une formation insuffisante, ou au contraire excessive, de syncytia, caractérisée en ce qu'elle comprend la détection dans un échantillon biologique d'au moins une protéine mutante selon l'une quelconque des revendications 1 à 38 ou d'au moins un acide nucléique selon la revendication 39.

57. Méthode in vitro pour le criblage d'un composé capable de diminuer ou bloquer la formation de syncytia, caractérisée en ce qu'elle comprend la mise en contact d'un composé candidat avec des cellules exprimant au moins une protéine mutante selon l'une quelconque des revendications 1 à 38, de sorte à déterminer si ce composé candidat diminue ou bloque la fusion desdites cellules.

58. Cellule tumorale, plus particulièrement myélome, comprenant au moins une protéine mutante selon l'une quelconque des revendications 1 à 38, préférentiellement comprenant au moins une telle protéine mutante à sa surface, et/ou comprenant au moins un acide nucléique selon la revendication 39, et/ou comprenant au moins un vecteur selon l'une quelconque des revendications 40, 41, 45.

59. La cellule tumorale, plus particulièrement le myélome, selon la revendication 58, pour une utilisation dans la production d'un hybridome.

60. Hybridome, caractérisé en ce qu'il comprend au moins une protéine mutante selon l'une quelconque des revendications 1 à 38, et/ou au moins un acide nucléique selon la revendication 39, et/ou au moins un vecteur selon l'une quelconque des revendications 40, 41, 45.

61. Cellule souche ou progénitrice, présentant une capacité de différentiation en cellule musculaire, caractérisée en ce qu'elle comprend au moins une protéine mutante selon l'une quelconque des revendications 1 à 38, préférentiellement comprenant au moins une telle protéine mutante à sa surface, et/ou comprenant au moins un acide nucléique selon la revendication 39, et/ou comprenant au moins un vecteur selon l'une quelconque des revendications 40, 41, 45, ladite cellule n'étant pas une cellule embryonnaire humaine.

62. La cellule souche ou progénitrice de la revendication 61, pour une utilisation en tant que cellule souche ou progénitrice de fibre musculaire.


Feedback