{"search_session":{},"preferences":{"l":"fr","queryLanguage":"fr"},"patentId":"164-554-898-904-446","frontPageModel":{"patentViewModel":{"ref":{"entityRefId":"164-554-898-904-446","entityRefType":"PATENT"},"entityMetadata":{"linkedIds":{"empty":true},"tags":[],"collections":[{"id":10834,"type":"PATENT","title":"University of Utah - Patent Portfolio","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":9195,"tags":[],"user":{"id":91044780,"username":"Cambialens","firstName":"","lastName":"","created":"2015-05-04T00:55:26.000Z","displayName":"Cambialens","preferences":"{\"usage\":\"public\",\"beta\":false}","accountType":"PERSONAL","isOauthOnly":false},"notes":[{"id":8283,"type":"COLLECTION","user":{"id":91044780,"username":"Cambialens","firstName":"","lastName":"","created":"2015-05-04T00:55:26.000Z","displayName":"Cambialens","preferences":"{\"usage\":\"public\",\"beta\":false}","accountType":"PERSONAL","isOauthOnly":false},"text":"
Search Applicants and Owners separately: Univ* AND Utah NOT state;
Select more for logical variants. Add to collection. Select all patents in the collection and expand by simple families. Add to collection. Total patents: 7034
Search Applicants and Owners separately: Univ* AND Utah NOT state;
Select more for logical variants. Add to collection. Select all patents in the collection and expand by simple families. Add to collection. Total patents: 7034
wherein Xaa 1 is des-Xaa 1 or Gly;
Xaa 2 is des-Xaa 2 , Pro, hydroxy-Pro (Hyp), Ala, His or Gly;
Xaa 3 is des-Xaa 3 , Ser, Val, Pro, Hyp, Thr, g-Ser, g-Thr, g-Hyp or any non-natural hydroxylated amino acid;
Xaa 4 is des-Xaa 4 , Gly, Glu, γ-carboxy-Glu (Gla), Phe, Pro, Hyp, Arg, Lys, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 5 is an aliphatic amino acid bearing linear or branched saturated hydrocarbon chains selected from the group consisting of Leu (D or L), Ile and Val or non-natural derivatives of the aliphatic amino acid, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys, any non-natural basic amino acid, Gly, Trp (D or L), neo-Trp, halo-Trp (D or L), or any aromatic non-natural amino acid;
Xaa 6 is Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys, any non-natural basic amino acid, Ala, an aliphatic amino acid bearing linear or branched saturated hydrocarbon chains selected from the group consisting of Leu (D or L), Ile and Val or non-natural derivatives of the aliphatic amino acid, Thr, Ser, g-Thr or g-Ser; Xaa 7 is Gly, Asp, Glu, Gla, Asn, Gln or any non-natural acidic amino acid;
Xaa 8 is Gly, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys, any non-natural basic amino acid, Asp, Glu, Gla, Asn, Gln or any non-natural acidic amino acid;
Xaa 9 is Ala, Val, Met, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 10 is Ala, His, Ser, Thr, Pro, Hyp, g-Ser, g-Thr, g-Hyp, any non-natural hydroxylated amino acid, Asp, Glu, Gla, Asn, Gln, any non-natural acidic amino acid, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 11 is Gly, Ser, Thr, g-Ser, g-Thr, Asp, Glu, Gla, any non-natural acidic amino acid, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 12 is Asn, Phe, Tyr, meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr, any non-natural aromatic amino acid, Gln or Leu (D or L);
Xaa 13 is Ser, Thr, g-Ser, g-Thr or His;
Xaa 14 is Ala, Gla, Ser, Thr, g-Ser, g-Thr, His, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 15 is Asp, Glu, His or Gla; Xaa 16 is des-Xaa 16 , Gly, His, Ser, Pro, Hyp, Thr, g-Ser, g-Thr, g-Hyp, any non-natural hyrdroxylated amino acid, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 17 is des-Xaa 17 , His, Ser, Thr, g-Ser, g-Thr, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys, any non-natural basic amino acid, Phe, Tyr, meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr,O-phospho-Tyr, nitro-Tyr or any non-natural aromatic amino acid;
Xaa 18 is Val, Asn, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 19 is des-Xaa 19 , Leu (D or L), Pro, Hyp, Phe, Tyr, meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any non-natural aromatic amino acid;
Xaa 20 is Gly, Ile, Ser, Thr, g-Ser, g-Thr, His, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys, any non-natural basic amino acid, Phe, Tyr, meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any non-natural aromatic amino acid;
Xaa 21 is Ser, Thr, g-Ser, g-Thr, an aliphatic amino acids bearing linear or branched saturated hydrocarbon chains such as Leu (D or L), Ile and Val and non-natural derivatives of the aliphatic amino acid, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys, any non-natural basic amino acid, Phe, Tyr, meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any non-natural aromatic amino acid;
Xaa 22 is Ala, Gln, Gla, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 23 is Ser, Pro, Hyp, Thr, g-Ser, g-Thr, g-Hyp, any non-natural hyrdroxylated amino acid, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 24 is Gln, Ser, Pro, Hyp, Thr, g-Ser, g-Thr, g-Hyp or any non-natural hyrdroxylated amino acid;
Xaa 25 is des-Xaa 25 , Ser, Thr, g-Ser or g-Thr;
Xaa 26 is des-Xaa 26 , Asn, Gln, Ser, Thr, g-Asn, g-Ser or g-Thr;
Xaa 27 is des-Xaa 27 , Val, Gla, Trp (D or L), neo-Trp, halo-Trp (D or L), any aromatic non-natural amino acid, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 28 is des-Xaa 28 , an aliphatic amino acids bearing linear or branched saturated hydrocarbon chains selected from the group consisting of Leu (D or L), Ile and Val and non-natural derivatives of the aliphatic amino acid;
Xaa 29 is des-Xaa 29 , an aliphatic amino acids bearing linear or branched saturated hydrocarbon chains selected from the group consisting of Leu (D or L), Ile and Val and non-natural derivatives of the aliphatic amino acid; Xaa 30 is des-Xaa 30 , Ile, Ser, Pro, Hyp, Thr, g-Ser, g-Thr, g-Hyp, any non-natural hydroxylated amino acid, Phe, Tyr, meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any non-natural aromatic amino acid;
Xaa 31 is des-Xaa 31 or Gly;
Xaa 32 is Ser, Thr, g-Ser, g-Thr, Trp (D or L), neo-Trp, halo-Trp (D or L), any aromatic non-natural amino acid, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid; Xaa 33 is Val, Ser, Thr, g-Ser, g-Thr, Tip (D or L), neo-Trp, halo-Trp (D or L) or any aromatic non-natural amino acid;
Xaa 34 is Gly, Ile, Asp, Glu, Gla, Asn, Ser, Thr, g-Asn, g-Ser or g-Thr;
Xaa 35 is des-Xaa 35 , Val, Met, Gln, Pro, Hyp, Ser, Thr, g-Ser, g-Thr, g-Hyp or any non-natural hydroxylated amino acid;
Xaa 36 is des-Xaa 36 , Val, Thr, Ser, g-Thr, g-Ser, Phe, Tyr, meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any non-natural aromatic amino acid;
Xaa 37 is des-Xaa 37 , Gln, Asn, Thr, Ser, g-Ser, g-Ser, g-Asn, Met, Leu, Phe, Tyr, meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr, any non-natural aromatic amino acid, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid; Xaa 38 is des-Xaa 38 , Leu, Ser, Thr, g-Ser, g-Thr, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid;
Xaa 39 is des-Xaa 39 , Ile, Ala, Thr, Ser, g-Ser, g-Thr, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic
amino acid;
Xaa 40 is des-Xaa 40 , Asp, Lys, Arg, ornithine, homo-Lys, homoarginine, nor-Lys, N-methyl-Lys, N,N′-dimethyl-Lys, N,N′,N″-trimethyl-Lys or any non-natural basic amino acid; and
Xaa 41 is des-Xaa 41 , Phe, Tyr, meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any non-natural aromatic amino acid,
with the proviso that the peptide is not J029 (SEQ ID NO:2)."],"number":1,"annotation":false,"claim":true,"title":false},{"lines":["A pharmaceutical composition comprising a I-conotoxin peptide of claim 1 or a pharmaceutically acceptable salt or solvate thereof and a pharmaceutically acceptable carrier."],"number":2,"annotation":false,"claim":true,"title":false},{"lines":["The substantially pure I-conotoxin peptide which comprises the amino acid sequence Gly-Xaa3-Ser-Phe-Cys-Lys-Ala-Asn-Gly-Lys-Xaa3-Cys-Ser-Xaa5-His-Ala-Asp-Cys-Cys-Asn-Cys-Cys-Leu-Ser-Gly-Ile-Cys-Lys-Xaa3-Ser-Thr-Asn-Val-Ile-Leu-Xaa3-Gly-Cys-Ser-Thr-Ser-Ser-Phe-Phe-Arg-Ile (SEQ IDNO:46), wherein Xaa3 is Pro or hydroxy-Pro, Xaa5 is Tyr, 125 I-Tyr, mono-iodo-Tyr, di-iodo-Tyr, O-suipho-Tyr or O-phospho-Tyr and the C-terminus is a free carboxyl or is amidated."],"number":3,"annotation":false,"claim":true,"title":false},{"lines":["The substantially pure I-conotoxin peptide of claim 3 wherein Xaa3 at residues 2, 11 and 29 are hydroxy-Pro, Xaa3 at residue 36 is Pro, Xaa5 is Tyr, and the C-terminus is amidated."],"number":4,"annotation":false,"claim":true,"title":false},{"lines":["The substantially pure I-conotoxin protein precursor which comprises the amino acid sequence MKLCLTFLLVLMILASVTGEKSSKHTLSRAARVKNRGPSFCKANGKPCSYHADCCNCCL SGICKPSTNVILPGCSTSSFFRI (SEQ ID NO:45)."],"number":5,"annotation":false,"claim":true,"title":false},{"lines":["A pharmaceutical composition comprising a I-conotoxin peptide of claim 3 or a pharmaceutically acceptable salt or solvate thereof and a pharmaceutically acceptable carrier."],"number":6,"annotation":false,"claim":true,"title":false},{"lines":["A pharmaceutical composition comprising a I-conotoxin peptide of claim 4 or a pharmaceutically acceptable salt or solvate thereof and a pharmaceutically acceptable carrier."],"number":7,"annotation":false,"claim":true,"title":false}]}},"filters":{"npl":[],"notNpl":[],"applicant":[],"notApplicant":[],"inventor":[],"notInventor":[],"owner":[],"notOwner":[],"tags":[],"dates":[],"types":[],"notTypes":[],"j":[],"notJ":[],"fj":[],"notFj":[],"classIpcr":[],"notClassIpcr":[],"classNat":[],"notClassNat":[],"classCpc":[],"notClassCpc":[],"so":[],"notSo":[],"sat":[]},"sequenceFilters":{"s":"SEQIDNO","d":"ASCENDING","p":0,"n":10,"sp":[],"si":[],"len":[],"t":[],"loc":[]}}