{"search_session":{},"preferences":{"l":"en","queryLanguage":"en"},"patentId":"031-965-843-234-266","frontPageModel":{"patentViewModel":{"ref":{"entityRefId":"031-965-843-234-266","entityRefType":"PATENT"},"entityMetadata":{"linkedIds":{"empty":true},"tags":[],"collections":[{"id":22749,"type":"PATENT","title":"Citing Zhejiang Univ publications","description":"Patent documents citing scholarly work of Zhejiang Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":8978,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:50:00Z","updated":"2017-08-07T04:50:00Z","lastEventDate":"2017-08-07T04:50:00Z"},{"id":22756,"type":"PATENT","title":"Citing SUNYS publications","description":"Patent documents citing scholarly work of SUNYS","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":51828,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:52:17Z","updated":"2017-08-07T04:52:17Z","lastEventDate":"2017-08-07T04:52:17Z"},{"id":22864,"type":"PATENT","title":"Citing Ohio State Univ publications","description":"Patent documents citing scholarly work of Ohio State Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":31507,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:42:04Z","updated":"2017-08-07T05:42:04Z","lastEventDate":"2017-08-07T05:42:04Z"},{"id":22871,"type":"PATENT","title":"Citing Univ Aix-Marseille publications","description":"Patent documents citing scholarly work of Univ Aix-Marseille","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":12318,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:44:42Z","updated":"2017-08-07T05:44:42Z","lastEventDate":"2017-08-07T05:44:42Z"},{"id":22886,"type":"PATENT","title":"Citing Univ Texas System publications","description":"Patent documents citing scholarly work of Univ Texas System","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":110344,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:51:34Z","updated":"2017-08-07T05:51:34Z","lastEventDate":"2017-08-07T05:51:34Z"},{"id":23043,"type":"PATENT","title":"Citing CSIRO publications","description":"Patent documents citing scholarly work of CSIRO","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":19101,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:23:03Z","updated":"2017-08-15T06:23:03Z","lastEventDate":"2017-08-15T06:23:03Z"},{"id":185281,"type":"PATENT","title":"lens-seq-2014-2014-seq-pubyr-families","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":27085,"tags":[],"user":{"id":11753382,"username":"poldham","firstName":"Paul","lastName":"Oldham","created":"2013-11-12T12:46:15.000Z","displayName":"Paul Oldham","profilePictureKey":"lens/users/5c122e46-fca5-4dba-a591-52919b87fbd0/profile-picture","preferences":"{}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2020-11-10T13:47:28Z","updated":"2020-11-10T13:48:27Z","lastEventDate":"2020-11-10T13:48:27Z"}],"notes":[],"inventorships":[],"privateCollections":[],"publicCollections":[{"id":22749,"type":"PATENT","title":"Citing Zhejiang Univ publications","description":"Patent documents citing scholarly work of Zhejiang Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":8978,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:50:00Z","updated":"2017-08-07T04:50:00Z","lastEventDate":"2017-08-07T04:50:00Z"},{"id":22756,"type":"PATENT","title":"Citing SUNYS publications","description":"Patent documents citing scholarly work of SUNYS","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":51828,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:52:17Z","updated":"2017-08-07T04:52:17Z","lastEventDate":"2017-08-07T04:52:17Z"},{"id":22864,"type":"PATENT","title":"Citing Ohio State Univ publications","description":"Patent documents citing scholarly work of Ohio State Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":31507,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:42:04Z","updated":"2017-08-07T05:42:04Z","lastEventDate":"2017-08-07T05:42:04Z"},{"id":22871,"type":"PATENT","title":"Citing Univ Aix-Marseille publications","description":"Patent documents citing scholarly work of Univ Aix-Marseille","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":12318,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:44:42Z","updated":"2017-08-07T05:44:42Z","lastEventDate":"2017-08-07T05:44:42Z"},{"id":22886,"type":"PATENT","title":"Citing Univ Texas System publications","description":"Patent documents citing scholarly work of Univ Texas System","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":110344,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:51:34Z","updated":"2017-08-07T05:51:34Z","lastEventDate":"2017-08-07T05:51:34Z"},{"id":23043,"type":"PATENT","title":"Citing CSIRO publications","description":"Patent documents citing scholarly work of CSIRO","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":19101,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:23:03Z","updated":"2017-08-15T06:23:03Z","lastEventDate":"2017-08-15T06:23:03Z"},{"id":185281,"type":"PATENT","title":"lens-seq-2014-2014-seq-pubyr-families","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":27085,"tags":[],"user":{"id":11753382,"username":"poldham","firstName":"Paul","lastName":"Oldham","created":"2013-11-12T12:46:15.000Z","displayName":"Paul Oldham","profilePictureKey":"lens/users/5c122e46-fca5-4dba-a591-52919b87fbd0/profile-picture","preferences":"{}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2020-11-10T13:47:28Z","updated":"2020-11-10T13:48:27Z","lastEventDate":"2020-11-10T13:48:27Z"}],"privateNotes":[],"landscapeCollections":[],"landscapeNotes":[]},"document":{"record_lens_id":"031-965-843-234-266","lens_id":["031-965-843-234-266","139-910-290-406-571"],"doc_key":"US_8829164_B2_20140909","created":"2016-01-15T08:35:00.148","docdb_id":421620608,"lens_internal":{"earliest_lens_id_created_time":"2016-01-15T08:35:00.148","last_modified":"2024-03-26T00:52:26.263","legacy_pub_key":"US_8829164_B2","has_doc_lang":true,"has_biblio_lang":true,"has_all_title_lang":true,"has_all_abstract_lang":true,"has_all_claims_lang":true,"has_description_lang":true},"jurisdiction":"US","doc_number":"8829164","kind":"B2","date_published":"2014-09-09","year_published":2014,"ids":["US_8829164_B2","031-965-843-234-266","139-910-290-406-571","US_8829164_B2_20140909","US","8829164","B2","US8829164B2","US8829164","8829164B2"],"lang":"en","publication_type":"GRANTED_PATENT","application_reference":{"jurisdiction":"US","doc_number":"201314070070","kind":"A","date":"2013-11-01"},"priority_claim":[{"jurisdiction":"US","doc_number":"201314070070","kind":"A","date":"2013-11-01"},{"jurisdiction":"US","doc_number":"201113177071","kind":"A","date":"2011-07-06"},{"jurisdiction":"US","doc_number":"201161466679","kind":"P","date":"2011-03-23"},{"jurisdiction":"US","doc_number":"36180810","kind":"P","date":"2010-07-06"}],"priority_claim.source":"DOCDB","earliest_priority_claim_date":"2010-07-06","title":{"en":[{"text":"Anti-ron antibodies","lang":"en","source":"DOCDB","data_format":"DOCDBA"}]},"title_lang":["en"],"has_title":true,"applicant":[{"name":"AVEO PHARMACEUTICALS INC","residence":"US","sequence":1,"app_type":"applicant"}],"applicant_count":1,"has_applicant":true,"inventor":[{"name":"WHALEN KERRY","residence":"US","sequence":1},{"name":"BOTTEGA STEVE","residence":"US","sequence":2},{"name":"BOUDROW ANDREA","residence":"US","sequence":3},{"name":"BREAULT LYNE","residence":"US","sequence":4},{"name":"CHEN TING","residence":"US","sequence":5},{"name":"GIFFORD JAMES","residence":"US","sequence":6},{"name":"HAN MAY","residence":"US","sequence":7},{"name":"JIANG JINWEI","residence":"US","sequence":8},{"name":"LERNER LORENA","residence":"US","sequence":9},{"name":"LIU QING","residence":"US","sequence":10},{"name":"MEETZE KRISTAN","residence":"US","sequence":11},{"name":"VINCENT SYLVIE","residence":"US","sequence":12},{"name":"WEILER SOLLY","residence":"US","sequence":13},{"name":"WINSTON JR WILLIAM M","residence":"US","sequence":14},{"name":"GYURIS JENO","residence":"US","sequence":15}],"inventor_count":15,"has_inventor":true,"agent":[{"name":"Goodwin Procter LLP","sequence":1}],"agent_count":1,"has_agent":true,"owner":[{"name":"AVEO PHARMACEUTICALS INC","address":"75 SIDNEY STREET, 4TH FLOOR, CAMBRIDGE, MASSACHUSETTS, 02139","sequence":4,"recorded_date":"2013-11-14","execution_date":"2011-09-29","is_current_owner":true}],"owner_count":1,"owner_all":[{"name":"AVEO PHARMACEUTICALS INC","address":"75 SIDNEY STREET, 4TH FLOOR, CAMBRIDGE, MASSACHUSETTS, 02139","sequence":4,"recorded_date":"2013-11-14","execution_date":"2011-09-29","is_current_owner":true}],"owner_all_count":1,"has_owner":true,"primary_examiner":{"name":"Brian J Gangle","department":"1646"},"assistant_examiner":{"name":"Andrea McCollum"},"has_examiner":true,"class_ipcr":[{"symbol":"C07K16/30","version_indicator":"2006-01-01","class_symbol_position":"F","class_value":"I","action_date":"2014-09-09","class_status":"B","class_data_source":"H","generating_office":"US","sequence":1}],"class_ipcr.first_symbol":"C07K16/30","class_ipcr.later_symbol":[],"class_ipcr.inv_symbol":["C07K16/30"],"class_ipcr.add_symbol":[],"class_ipcr.source":"DOCDB","class_cpc":[{"symbol":"A61K2039/505","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2013-01-01","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":1},{"symbol":"C07K16/2896","version_indicator":"2013-01-01","class_symbol_position":"F","class_value":"I","action_date":"2022-09-14","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":2},{"symbol":"C07K2317/24","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2013-01-01","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":3},{"symbol":"C07K2317/73","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2013-01-01","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":4},{"symbol":"C07K2317/76","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2013-01-01","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":5},{"symbol":"C07K2317/77","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2013-01-01","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":6},{"symbol":"C07K2317/92","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2013-01-01","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":7},{"symbol":"A61P35/00","version_indicator":"2018-01-01","class_symbol_position":"L","class_value":"I","action_date":"2020-03-27","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":8},{"symbol":"C07K2317/77","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2019-10-11","class_status":"B","class_data_source":"H","generating_office":"US","sequence":9},{"symbol":"C07K2317/76","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2019-10-11","class_status":"B","class_data_source":"H","generating_office":"US","sequence":10},{"symbol":"A61K2039/505","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2019-10-11","class_status":"B","class_data_source":"H","generating_office":"US","sequence":11},{"symbol":"C07K2317/92","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2019-10-11","class_status":"B","class_data_source":"H","generating_office":"US","sequence":12},{"symbol":"C07K2317/73","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2019-10-11","class_status":"B","class_data_source":"H","generating_office":"US","sequence":13},{"symbol":"C07K16/2896","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"I","action_date":"2019-10-11","class_status":"B","class_data_source":"H","generating_office":"US","sequence":14},{"symbol":"C07K2317/24","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2019-10-11","class_status":"B","class_data_source":"H","generating_office":"US","sequence":15},{"symbol":"C07K16/30","version_indicator":"2013-01-01","class_symbol_position":"F","class_value":"I","action_date":"2014-02-27","class_status":"B","class_data_source":"H","generating_office":"US","sequence":16}],"class_cpc_cset":[],"class_cpc.first_symbol":"C07K16/2896","class_cpc.later_symbol":["A61K2039/505","C07K2317/24","C07K2317/73","C07K2317/76","C07K2317/77","C07K2317/92","A61P35/00","C07K2317/77","C07K2317/76","A61K2039/505","C07K2317/92","C07K2317/73","C07K16/2896","C07K2317/24"],"class_cpc.inv_symbol":["C07K16/2896","A61P35/00","C07K16/2896","C07K16/30"],"class_cpc.add_symbol":["A61K2039/505","C07K2317/24","C07K2317/73","C07K2317/76","C07K2317/77","C07K2317/92","C07K2317/77","C07K2317/76","A61K2039/505","C07K2317/92","C07K2317/73","C07K2317/24"],"class_cpc.source":"DOCDB","class_national":[{"symbol":"530/387.3","symbol_position":"F"},{"symbol":"530/389.7","symbol_position":"L"}],"class_national.first_symbol":"530/387.3","class_national.later_symbol":["530/389.7"],"class_national.source":"DOCDB","reference_cited":[{"patent":{"num":1,"document_id":{"jurisdiction":"US","doc_number":"5707624","kind":"A","date":"1998-01-13","name":"NICKOLOFF BRIAN J [US], et al"},"lens_id":"102-631-344-071-371","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":1}},{"patent":{"num":2,"document_id":{"jurisdiction":"US","doc_number":"7235523","kind":"B2","date":"2007-06-26","name":"WALTZ SUSAN E [US], et al"},"lens_id":"197-076-590-864-963","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":2}},{"patent":{"num":3,"document_id":{"jurisdiction":"US","doc_number":"7498416","kind":"B2","date":"2009-03-03","name":"YAYON AVNER [IL], et al"},"lens_id":"013-381-214-292-154","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":3}},{"patent":{"num":4,"document_id":{"jurisdiction":"US","doc_number":"2009136510","kind":"A1","date":"2009-05-28","name":"PEREIRA DANIEL [CA], et al"},"lens_id":"060-313-165-485-207","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":4}},{"patent":{"num":5,"document_id":{"jurisdiction":"US","doc_number":"2009202547","kind":"A1","date":"2009-08-13","name":"YAYON AVNER [IL], et al"},"lens_id":"041-371-441-441-793","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":5}},{"patent":{"num":6,"document_id":{"jurisdiction":"US","doc_number":"2009226442","kind":"A1","date":"2009-09-10","name":"HUET HEATHER [US], et al"},"lens_id":"167-489-140-367-676","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":6}},{"patent":{"num":7,"document_id":{"jurisdiction":"WO","doc_number":"2005120557","kind":"A2","date":"2005-12-22","name":"IMCLONE SYSTEMS INC [US], et al"},"lens_id":"115-106-003-226-992","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":7}},{"patent":{"num":8,"document_id":{"jurisdiction":"WO","doc_number":"2006020258","kind":"A2","date":"2006-02-23","name":"IMCLONE SYSTEMS INC [US], et al"},"lens_id":"197-423-015-814-509","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":8}},{"patent":{"num":9,"document_id":{"jurisdiction":"WO","doc_number":"2008100624","kind":"A2","date":"2008-08-21","name":"MERRIMACK PHARMACEUTICALS INC [US], et al"},"lens_id":"086-674-547-575-125","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":9}},{"patent":{"num":10,"document_id":{"jurisdiction":"WO","doc_number":"2009070294","kind":"A2","date":"2009-06-04","name":"IMCLONE SYSTEMS INC [US], et al"},"lens_id":"099-134-367-414-767","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":10}},{"patent":{"num":11,"document_id":{"jurisdiction":"WO","doc_number":"2009094148","kind":"A2","date":"2009-07-30","name":"BIOGEN IDEC INC [US], et al"},"lens_id":"180-766-426-085-045","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":11}},{"patent":{"num":12,"document_id":{"jurisdiction":"WO","doc_number":"2009134776","kind":"A2","date":"2009-11-05","name":"ABBOTT LAB [US], et al"},"lens_id":"190-969-160-193-913","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":12}},{"patent":{"num":13,"document_id":{"jurisdiction":"WO","doc_number":"2010037835","kind":"A2","date":"2010-04-08","name":"MICROMET AG [DE], et al"},"lens_id":"088-192-755-737-53X","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":13}},{"patent":{"num":14,"document_id":{"jurisdiction":"WO","doc_number":"2011090761","kind":"A1","date":"2011-07-28","name":"EMERGENT PRODUCT DEV SEATTLE [US], et al"},"lens_id":"049-864-938-590-838","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":14}},{"npl":{"num":1,"text":"Burgess et al. (2006) \"Fully Human Monoclonal Antibodies to Hepatocyte Growth Factor with Therapeutic Potential against Hepatocyte Growth Factor/c-Met-Dependent Human Tumors\" Cancer Res. 66:1721-1729.","npl_type":"a","external_id":["10.1158/0008-5472.can-05-3329","16452232"],"record_lens_id":"001-463-849-131-999","lens_id":["126-267-766-184-002","001-463-849-131-999","007-864-296-173-763"],"sequence":15,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":2,"text":"Camp et al. (2007) \"Tyrosine Kinase Receptor RON in Human Pancreatic Cancer-Expression, Function, and Validation as a Target\" Cancer 109:1030-1039.","npl_type":"a","external_id":["10.1002/cncr.22490","17311308"],"record_lens_id":"062-612-724-953-293","lens_id":["166-936-391-796-85X","062-612-724-953-293","179-643-045-949-641"],"sequence":16,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":3,"text":"Carter (2006) \"Potent Antibody Therapeutics by Design\" Nature Reviews. Immunology 6:343-357.","npl_type":"a","external_id":["16622479","10.1038/nri1837"],"record_lens_id":"015-462-197-604-87X","lens_id":["192-021-195-011-813","015-462-197-604-87X","123-536-156-583-018"],"sequence":17,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":4,"text":"Han et al. (2010) \"Anti-tumor activity of anti-RON antibodies and biomarker of response\" European Journal of Cancer. Supplement. Nov. 18, 2010, Plenary Session 6. Proffered papers. Abstract 2LB.","npl_type":"a","external_id":["10.1016/s1359-6349(10)71957-1"],"record_lens_id":"048-248-555-892-630","lens_id":["048-248-555-892-630","045-087-319-553-895"],"sequence":18,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":5,"text":"Hayden-Ledbetter et al. (2009) \"CD20-Directed Small Modular Immunopharmaceutical, TRU-015, Depletes Normal and Malignant B Cells\" Clin. Cancer Res. 15:2739-2746.","npl_type":"a","external_id":["10.1158/1078-0432.ccr-08-1694","19351771"],"record_lens_id":"008-903-683-344-417","lens_id":["009-125-099-359-845","121-678-455-163-92X","008-903-683-344-417"],"sequence":19,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":6,"text":"Lu et al. (2007) \"Multiple variants of the RON receptor tyrosine kinase: Biochemical properties, tumorigenic activities, and potential drug targets\" Cancer Lett. 257:157-164.","npl_type":"a","external_id":["17889431","10.1016/j.canlet.2007.08.007"],"record_lens_id":"071-810-989-798-587","lens_id":["111-377-164-700-287","071-810-989-798-587","079-748-060-290-318"],"sequence":20,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":7,"text":"Montero-Julian et al. (1998) \"Characterization of Two Monoclonal Antibodies Against the RON Tyrosine Kinase Receptor\" Hybridoma 17:541-551.","npl_type":"a","external_id":["9890710","10.1089/hyb.1998.17.541"],"record_lens_id":"030-067-456-710-524","lens_id":["081-019-956-258-769","030-067-456-710-524","117-714-706-349-763"],"sequence":21,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":8,"text":"O'Toole et al. (2006) \"Therapeutic Implications of a Human Neutralizing Antibody to the Macrophage-Stimulating Protein Receptor Tyrosine Kinase (RON), a c-MET Family Member\" Cancer Research 66:9162-9170.","npl_type":"a","external_id":["10.1158/0008-5472.can-06-0283","16982759"],"record_lens_id":"066-782-625-682-376","lens_id":["127-774-674-462-522","066-782-625-682-376","118-422-515-164-071"],"sequence":22,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":9,"text":"Qian et al. (2009) \"Inhibition of Tumor Cell Growth, Invasion, and Metastasis by EXEL-2880 (XL880, GSK1363089), a Novel Inhibitor of HGF and VEGF Receptor Tyrosine Kinases\" Cancer Res. 69:8009-8016.","npl_type":"a","external_id":["19808973","10.1158/0008-5472.can-08-4889"],"record_lens_id":"024-224-600-414-463","lens_id":["103-889-253-329-116","081-500-014-770-946","024-224-600-414-463"],"sequence":23,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":10,"text":"Raeppel et al. (2010) \"Identification of a novel series of potent RON receptor tyrosine kinase inhibitors\" Bioorg Med Chem Lett 20:2745-9.","npl_type":"a","external_id":["10.1016/j.bmcl.2010.03.073","20363625"],"record_lens_id":"064-975-216-239-945","lens_id":["169-974-541-955-825","140-022-541-524-696","064-975-216-239-945"],"sequence":24,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":11,"text":"Rampino et al. (2007) \"Neutralization of macrophage-stimulating protein ameliorates renal injury in anti-thy 1 glomerulonephritis\" Journal of the American Society of Nephrology 18:1486-1496.","npl_type":"a","external_id":["10.1681/asn.2006060680","17409315"],"record_lens_id":"009-262-032-563-586","lens_id":["038-159-331-828-413","009-262-032-563-586","168-940-449-488-53X"],"sequence":25,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":12,"text":"Schroeder et al. (2009) \"Discovery of N-(4-(2-Amino-3-chloropyridin-4-yloxy)-3-fluorophenyl)-4-ethoxy-1-(4-fluorophenyl)-2-oxo-1,2-dihydropyridine-3-carboxamide (BMS-777607), a Selective and Orally Efficacious Inhibitor of the Met Kinase Superfamily\" J. Med Chem. 52:1251-1254.","npl_type":"a","external_id":["10.1021/jm801586s","19260711"],"record_lens_id":"025-690-421-814-909","lens_id":["158-580-594-978-851","174-123-202-044-918","025-690-421-814-909"],"sequence":26,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":13,"text":"Secco et al. (2004) \"Characterization of a single-chain intrabody directed against the human receptor tyrosine kinase Ron\" Journal of Immunological Methods 285:99-109.","npl_type":"a","external_id":["14871539","10.1016/j.jim.2003.11.003"],"record_lens_id":"014-921-354-140-620","lens_id":["034-459-481-528-01X","014-921-354-140-620","176-256-996-169-473"],"sequence":27,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":14,"text":"Wagh et al. (2008) \"Met Related Receptor Tyrosine Kinase Ron in Tumor Growth and Metastasis\" Adv. Cancer Res. 100:1-33.","npl_type":"a","external_id":["10.1016/s0065-230x(08)00001-8","18620091","pmc4102433"],"record_lens_id":"042-911-743-476-335","lens_id":["106-956-404-721-067","136-887-079-062-978","042-911-743-476-335"],"sequence":28,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":15,"text":"Wark et al. (2006) \"Latest technologies for the enhancement of antibody affinity\" Advanced Drug Delivery Reviews 58:657-670.","npl_type":"a","external_id":["16828920","10.1016/j.addr.2006.01.025"],"record_lens_id":"037-311-825-494-588","lens_id":["041-231-768-642-189","037-311-825-494-588","185-183-018-109-463"],"sequence":29,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":16,"text":"Yao et al. (2006) \"Agonistic Monoclonal Antibodies Potentiate Tumorigenic and Invasive Activities of Splicing Variant of the RON Receptor Tyrosine Kinase\" Cancer Biology and Therapy 5:1179-1186.","npl_type":"a","external_id":["10.4161/cbt.5.9.3073","16880737"],"record_lens_id":"073-629-326-635-206","lens_id":["079-998-313-065-402","173-569-538-614-662","073-629-326-635-206"],"sequence":30,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":17,"text":"Zhang et al. (2008) \"Identification of a Novel Recepteur d'Origine Nantais/c-Met Small-Molecule Kinase Inhibitor with Antitumor Activity In vivo\" Cancer Res. 68:6680-6687.","npl_type":"a","external_id":["18701492","10.1158/0008-5472.can-07-6782"],"record_lens_id":"019-440-561-609-748","lens_id":["127-914-498-609-194","033-209-445-198-481","019-440-561-609-748"],"sequence":31,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":18,"text":"Zhao et al. (2007) \"Targeting CD37-positive lymphoid malignancies with a novel engineered small modular immunopharmaceutical\" Blood 110:2569-2577.","npl_type":"a","external_id":["10.1182/blood-2006-12-062927","pmc1988922","17440052"],"record_lens_id":"061-670-826-596-767","lens_id":["112-326-910-953-750","061-670-826-596-767","154-716-071-414-98X"],"sequence":32,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":19,"text":"Product insert for Human MSP R/Ron Antibody; Monoclonal Mouse IgG1 Clone #99211; Catalog No. MAB691 (R&D Systems) (1 page) (2010).","npl_type":"a","external_id":[],"lens_id":[],"sequence":33,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":20,"text":"International Search Report and Written Opinion, International Patent Application No. PCT/US2011/043056, mailed on Jan. 24, 2012 (27 pages).","npl_type":"a","external_id":[],"lens_id":[],"sequence":34,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}}],"reference_cited.source":"DOCDB","reference_cited.patent_count":14,"cites_patent":true,"reference_cited.npl_count":20,"reference_cited.npl_resolved_count":18,"cites_npl":true,"cites_resolved_npl":true,"cited_by":{"patent_count":0,"patent":[]},"cited_by_patent":false,"family":{"simple":{"size":13,"id":192267566,"member":[{"lens_id":"194-980-214-870-688","document_id":{"jurisdiction":"US","doc_number":"20140066603","kind":"A1","date":"2014-03-06"}},{"lens_id":"092-369-764-845-984","document_id":{"jurisdiction":"US","doc_number":"8603478","kind":"B2","date":"2013-12-10"}},{"lens_id":"148-098-264-056-418","document_id":{"jurisdiction":"JP","doc_number":"2013533746","kind":"A","date":"2013-08-29"}},{"lens_id":"174-984-598-445-527","document_id":{"jurisdiction":"US","doc_number":"20120027773","kind":"A1","date":"2012-02-02"}},{"lens_id":"031-965-843-234-266","document_id":{"jurisdiction":"US","doc_number":"8829164","kind":"B2","date":"2014-09-09"}},{"lens_id":"084-477-722-428-822","document_id":{"jurisdiction":"AR","doc_number":"082194","kind":"A1","date":"2012-11-21"}},{"lens_id":"065-231-474-056-513","document_id":{"jurisdiction":"CA","doc_number":"2804399","kind":"A1","date":"2012-01-12"}},{"lens_id":"137-122-032-120-677","document_id":{"jurisdiction":"AU","doc_number":"2011276285","kind":"A1","date":"2013-01-24"}},{"lens_id":"132-032-536-252-242","document_id":{"jurisdiction":"AU","doc_number":"2011276285","kind":"A2","date":"2013-02-28"}},{"lens_id":"032-466-971-213-89X","document_id":{"jurisdiction":"WO","doc_number":"2012006341","kind":"A8","date":"2013-01-31"}},{"lens_id":"008-957-632-386-725","document_id":{"jurisdiction":"WO","doc_number":"2012006341","kind":"A2","date":"2012-01-12"}},{"lens_id":"112-793-225-555-204","document_id":{"jurisdiction":"WO","doc_number":"2012006341","kind":"A3","date":"2012-03-22"}},{"lens_id":"060-068-243-730-92X","document_id":{"jurisdiction":"EP","doc_number":"2591005","kind":"A2","date":"2013-05-15"}}]},"extended":{"size":13,"id":192119538,"member":[{"lens_id":"194-980-214-870-688","document_id":{"jurisdiction":"US","doc_number":"20140066603","kind":"A1","date":"2014-03-06"}},{"lens_id":"092-369-764-845-984","document_id":{"jurisdiction":"US","doc_number":"8603478","kind":"B2","date":"2013-12-10"}},{"lens_id":"148-098-264-056-418","document_id":{"jurisdiction":"JP","doc_number":"2013533746","kind":"A","date":"2013-08-29"}},{"lens_id":"174-984-598-445-527","document_id":{"jurisdiction":"US","doc_number":"20120027773","kind":"A1","date":"2012-02-02"}},{"lens_id":"031-965-843-234-266","document_id":{"jurisdiction":"US","doc_number":"8829164","kind":"B2","date":"2014-09-09"}},{"lens_id":"065-231-474-056-513","document_id":{"jurisdiction":"CA","doc_number":"2804399","kind":"A1","date":"2012-01-12"}},{"lens_id":"084-477-722-428-822","document_id":{"jurisdiction":"AR","doc_number":"082194","kind":"A1","date":"2012-11-21"}},{"lens_id":"137-122-032-120-677","document_id":{"jurisdiction":"AU","doc_number":"2011276285","kind":"A1","date":"2013-01-24"}},{"lens_id":"132-032-536-252-242","document_id":{"jurisdiction":"AU","doc_number":"2011276285","kind":"A2","date":"2013-02-28"}},{"lens_id":"032-466-971-213-89X","document_id":{"jurisdiction":"WO","doc_number":"2012006341","kind":"A8","date":"2013-01-31"}},{"lens_id":"008-957-632-386-725","document_id":{"jurisdiction":"WO","doc_number":"2012006341","kind":"A2","date":"2012-01-12"}},{"lens_id":"112-793-225-555-204","document_id":{"jurisdiction":"WO","doc_number":"2012006341","kind":"A3","date":"2012-03-22"}},{"lens_id":"060-068-243-730-92X","document_id":{"jurisdiction":"EP","doc_number":"2591005","kind":"A2","date":"2013-05-15"}}]}},"sequence":{"seq_list_key":"US_8829164_B2","type":["N","DNA","P"],"length_bucket":["NT_1_100","AA_301","AA_51_300","NT_101_5000","AA_1_50"],"length":[642,5,6,7,8,648,9,10,11,12,13,14,654,15,16,17,657,18,660,20,21,22,23,27,1320,1323,45,1329,1335,440,441,315,443,445,1341,318,447,1344,448,321,451,324,1353,330,972,333,336,214,216,345,218,219,348,220,990,351,354,357,105,106,363,107,110,111,112,115,116,117,118,119,121],"organism":[{"name":"Unknown/Artificial","tax_id":-1}],"document_location":["BDRAW","DDESC","CLAIM"],"count":178,"data_source":["USPTO_FULLTEXT_RB","EMBLPAT_EBI","DDBJPAT","GBPAT_NCBI"]},"has_sequence":true,"legal_status":{"ipr_type":"patent for invention","granted":true,"earliest_filing_date":"2011-07-06","grant_date":"2014-09-09","anticipated_term_date":"2031-07-06","discontinuation_date":"2018-10-15","has_disclaimer":false,"patent_status":"INACTIVE","publication_count":2,"has_spc":false,"has_grant_event":false,"has_entry_into_national_phase":false},"abstract":{"en":[{"text":"Monoclonal antibodies that bind and inhibit activation of human RON (Recepteur d'Origine Nantais) are disclosed. The antibodies can be used to treat certain forms of cancer that are associated with activation of RON.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"}]},"abstract_lang":["en"],"has_abstract":true,"claim":{"en":[{"text":"1. An isolated antibody that binds human RON (Recepteur d'Origine Natais), comprising: (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 5 and SEQ ID NO: 124, a CDR H2 comprising the amino acid sequence of SEQ ID NO: 122, and a CDR H3 comprising the amino acid sequence of SEQ ID NO: 123; and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO: 130, a CDR L2 comprising the amino acid sequence of SEQ ID NO: 131, and a CDR L3 comprising the amino acid sequence of SEQ ID NO: 10.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"2. The antibody of claim 1 , wherein the immunoglobulin heavy chain variable region comprises a CDR H1 comprising the amino acid sequence of SEQ ID NO: 5, a CDR H2 comprising the amino acid sequence of SEQ ID NO: 122, and a CDR H3 comprising the amino acid sequence of SEQ ID NO: 123; and the immunoglobulin light chain variable region comprises a CDR L1 comprising the amino acid sequence of SEQ ID NO: 130, a CDR L2 comprising the amino acid sequence of SEQ ID NO: 131, and a CDR L3 comprising the amino acid sequence of SEQ ID NO: 10.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"3. The antibody of claim 1 , wherein the CDR sequences are interposed between human framework sequences.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"4. The antibody of claim 1 , wherein the immunoglobulin heavy chain variable region comprises a CDR H1 comprising the amino acid sequence of SEQ ID NO: 124, a CDR H2 comprising the amino acid sequence of SEQ ID NO: 122, and a CDR H3 comprising the amino acid sequence of SEQ ID NO: 123; and the immunoglobulin light chain variable region comprises a CDR L1 comprising the amino acid sequence of SEQ ID NO: 130, a CDR L2 comprising the amino acid sequence of SEQ ID NO: 131, and a CDR L3 comprising the amino acid sequence of SEQ ID NO: 10.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"5. The antibody of claim 1 , wherein the antibody is an antigen-binding fragment.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"6. The antibody of claim 1 , wherein the immunoglobulin heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 137 and the immunoglobulin light chain variable region comprises the amino acid sequence of SEQ ID NO: 139.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"7. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the amino acid sequence of SEQ ID NO: 166, and the immunoglobulin light chain comprises the amino acid sequence of SEQ ID NO: 168.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"8. The antibody of claim 1 , wherein the antibody binds human RON with a K D of 900 pM or lower as measured by surface plasmon resonance.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"9. The antibody of claim 8 , wherein the antibody binds human RON with a K D of 500 pM or lower as measured by surface plasmon resonance.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"10. The antibody of claim 9 , wherein the antibody binds human RON with a K D of 250 pM or lower as measured by surface plasmon resonance.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"11. The antibody of claim 1 , wherein the CDR sequences are interposed between humanized framework sequences.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"}]},"claim_lang":["en"],"has_claim":true,"description":{"en":{"text":"CROSS-REFERENCE TO RELATED APPLICATIONS This application is a divisional of U.S. patent application Ser. No. 13/177,071, filed Jul. 6, 2011, which claims the benefit of and priority to U.S. Provisional Application No. 61/466,679, filed Mar. 23, 2011, and U.S. Provisional Application Ser. No. 61/361,808, filed Jul. 6, 2010; the contents of each application are hereby incorporated by reference in their entirety. FIELD OF THE INVENTION The field of the invention is molecular biology, immunology and oncology. More particularly, the field is therapeutic antibodies. BACKGROUND Recepteur d'Origine Nantais (RON), also known as Macrophage Stimulating Protein Receptor (MSP R, or MST1-R), is a member of the MET family of receptor tyrosine kinases that binds the ligand known as Macrophage Stimulating Protein (MSP). RON is composed of a 40 kDa extracellular a chain and a 150 kDa transmembrane β chain. The β chain is responsible for the intrinsic kinase activity, and the extracellular portions of the two chains function together as the ligand binding domain (Wagh et al., 2008, A DV . C ANCER R ES. 100:1-33). MSP binding to RON activates multiple downstream signaling pathways and mediates multiple cellular activities. RON pathway dysregulation is involved in inflammatory response, wound healing and liver regeneration. RON signaling can sustain tumor growth, survival, motility, invasion and angiogenesis in certain malignancies. The RON protein exists in several splice variants, some of which are tumorigenic in animal models of cancer. One such splice variant is delta 160 RON, which lacks exons 5 and 6 (Lu et al., 2007, C ANCER L ETT. 257:157-164). When activated by ligand binding, RON activates the PI3K/AKT pathway and the MAPK pathway. RON also affects cells through interactions with other receptors, e.g., c-Met, integrins and EGFR. To date, no activating mutations in RON exons have been reported. Alternative splicing and overexpression appear to be the main mechanisms for constitutive activation of the receptor. Several small molecule inhibitors have been reported that inhibit multiple receptor tyrosine kinases, including RON, examples of which include EXCEL-2880, (Qian et al., 2009, C ANCER R ES. 69:8009-8016) and BMS-77607 (Schroeder et al., 2009 J. M ED C HEM. 52:1251-1254). A dual c-met/RON inhibitor has also been reported, Amgen compound I (Zhang et al., 2008, C ANCER R ES. 68:6680-6687). A recent publication describes a selective RON small molecule inhibitor (Raeppel et al., 2010 B IOORG M ED C HEM L ETT 20:2745-9). Several antibodies that inhibit human RON activity have been reported (Huet et al., US 2009/0226442; Pereira et al., US 2009/0136510; Zhu et al., WO 2006/020258; Pereira et al., WO 2005/120557; and commercial antibody MAB691, R&D Systems, Minneapolis, Minn.). Naturally occurring antibodies are multimeric proteins that contain four polypeptide chains ( FIG. 1 ). Two of the polypeptide chains are called heavy chains (H chains), and two of the polypeptide chains are called light chains (L chains). The immunoglobulin heavy and light chains are connected by an interchain disulfide bond. The immunoglobulin heavy chains are connected by interchain disulfide bonds. A light chain consists of one variable region (V L in FIG. 1 ) and one constant region (C L in FIG. 1 ). The heavy chain consists of one variable region (V H in FIG. 1 ) and at least three constant regions (CH 1 , CH 2 and CH 3 in FIG. 1 ). The variable regions determine the specificity of the antibody. Each variable region comprises three hypervariable regions also known as complementarity determining regions (CDRs) flanked by four relatively conserved framework regions (FRs). The three CDRs, referred to as CDR 1 , CDR 2 , and CDR 3 , contribute to the antibody binding specificity. Naturally occurring antibodies have been used as starting material for engineered antibodies, such as chimeric antibodies and humanized antibodies. Although antibodies that bind RON are known in the art, there is still a need for improved RON antibodies that can be used as therapeutic agents. SUMMARY The invention is based, in part, upon the discovery of a family of antibodies that specifically bind human RON. The antibodies contain RON binding sites based on the CDRs of the antibodies. The antibodies can be used as therapeutic agents. When used as therapeutic agents, the antibodies are engineered, e.g., humanized, to reduce or eliminate an immune response when administered to a human patient. The antibodies prevent or inhibit the activation of (i.e., neutralize) human RON. In some embodiments, the antibodies prevent RON from binding to its ligand, MSP, thereby neutralizing RON activity. In certain embodiments, the antibodies prevent RON activation without inhibiting RON binding to MSP. The antibodies can be used to inhibit the downstream signaling of the breast tumor cell line T47D. Furthermore, when administered to a mammal, the antibodies can inhibit or reduce tumor growth in the mammal. These and other aspects and advantages of the invention will become apparent upon consideration of the following figures, detailed description, and claims. As used herein, “including” means without limitation, and examples cited are non-limiting. DESCRIPTION OF THE DRAWINGS The invention can be more completely understood with reference to the following drawings. FIG. 1 (prior art) is a schematic representation of a typical naturally-occurring antibody. FIG. 2 is a sequence alignment showing the amino acid sequence of the complete immunoglobulin heavy chain variable region of antibodies 07F01, 12B11, 17F06, 18H09 and 29B06. The amino acid sequences for each antibody are aligned against one another, and CDR 1 , CDR 2 , and CDR 3 , are identified in boxes. The unboxed sequences represent framework (FR). Alignment positioning (gaps) are based on Kabat numbering, rather than an alignment algorithm such as Clustal sequences. FIG. 3 is a sequence alignment showing the CDR 1 , CDR 2 , and CDR 3 sequences for each of the immunoglobulin heavy chain variable region sequences in FIG. 2 . FIG. 4 is a sequence alignment showing the amino acid sequence of the complete immunoglobulin light chain variable region of antibodies 07F01, 12B11, 17F06, 18H09 and 29B06. The amino acid sequences for each antibody are aligned against one another, and CDR 1 , CDR 2 , and CDR 3 , are identified in boxes. The unboxed sequences represent framework (FR) sequences. Alignment positioning (gaps) are based on Kabat numbering, rather than an alignment algorithm such as Clustal sequences. FIG. 5 is a sequence alignment showing the CDR 1 , CDR 2 , and CDR 3 sequences for each of the immunoglobulin light chain variable region sequences in FIG. 4 . FIG. 6 is a graph showing dose-response curves for inhibition of the MSP-RON binding interaction by antibodies 17F06 (▴), 07F01 (●), 12B11 (♦), 18H09 (▪), and 29B06 (x), as measured by electrochemiluminescence assay. FIG. 7 is a graph showing dose-response curves for inhibition of MSP-dependent phosphorylation of ERK by antibodies 17F06 (▴), 07F01 (●), 12B11 (♦), 18H09 (▪), and 29B06 (x) by ELISA assay. FIG. 8 is a histogram summarizing results from an experiment measuring inhibition of MSP induced HPAF-II cell migration by antibodies 07F01, 18H09, 29B06, 12B11, 17F06 and an IgG negative control (murine IgG) by transwell assay. FIG. 9 is a graph summarizing data on inhibition of growth of a wild-type (wt) RON-dependent in vivo tumor model by antibodies 07F01 (●), 12B11 (♦), 18H09 (▪), 29B06 (*), and a murine IgG control (∘). The antibodies and IgG control were dosed at 20 mg/kg twice per week intraperitoneally. FIG. 10 is a graph summarizing data on inhibition of growth of a delta 160 RON-dependent in vivo tumor model by antibodies 17F06 (▴), 07F01 (●), 12B11 (♦), 18H09 (▪), 29B06 (*), and a murine IgG control (∘). The antibodies and IgG control were dosed at 20 mg/kg twice per week intraperitoneally. FIG. 11 is a graph summarizing data on inhibition of growth of an NCI-H358 xenograft tumor model by antibody 29B06 (*) and a murine IgG control (∘). The antibody and IgG control were dosed at 40 mg/kg (abbreviated as “mpk”) three per week intraperitoneally. FIG. 12A is a schematic diagram showing the amino acid sequences of the complete immunoglobulin heavy chain variable region of 07F01 (SEQ ID NO: 2) and the complete heavy chain variable regions denoted as Chimeric 07F01 C102S (SEQ ID NO: 133), Sh07F01 Hv3-48 (SEQ ID NO: 135), and Sh07F01 Hv3-48 D28T T60A L63V E65G (SEQ ID NO: 137). The amino acid sequences for each heavy chain variable region are aligned against one another, and Complementary Determining Sequences (CDR) (Kabat definition), CDR 1 , CDR 2 , and CDR 3 , are identified in boxes. The unboxed sequences represent framework (FR) sequences. FIG. 12B is a schematic diagram showing the amino acid sequences of the complete immunoglobulin heavy chain variable region of 29B06 (SEQ ID NO: 42) and the complete heavy chain variable regions denoted as Sh29B06_Hv4-59 (SEQ ID NO: 143), Hu29B06 Hv4-59 (SEQ ID NO: 145), and Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F (SEQ ID NO: 147). The amino acid sequences for each heavy chain variable region are aligned against one another, and CDR 1 , CDR 2 , and CDR 3 sequences (Kabat definition) are identified in boxes. The unboxed sequences represent framework (FR) sequences. FIG. 13A is a schematic diagram showing the CDR 1 , CDR 2 , and CDR 3 sequences (Kabat definition) for each of the variable region sequences shown in FIG. 12A . FIG. 13B is a schematic diagram showing the CDR 1 , CDR 2 , and CDR 3 sequences (Kabat definition) for each of the variable region sequences shown in FIG. 12B . FIG. 14A is a schematic diagram showing the amino acid sequences of the complete light chain variable region of 07F01 (SEQ ID NO: 4) and the complete light chain variable regions denoted as HE L 07F01 Kv1-9 (SEQ ID NO: 139) and Sh07F01 Kv1-9 F1 (SEQ ID NO: 141). The amino acid sequences for each light chain variable region are aligned against one another, and CDR 1 , CDR 2 , and CDR 3 sequences (Kabat definition) are identified in boxes. The unboxed sequences represent framework (FR) sequences. FIG. 14B is a schematic diagram showing the amino acid sequences of the complete light chain variable region of 29B06 (SEQ ID NO: 44) and the complete light chain variable region denoted as Sh29B06 Kv2-28 (SEQ ID NO: 149). The amino acid sequences for each light chain variable region are aligned against one another, and CDR 1 , CDR 2 , and CDR 3 sequences (Kabat definition) are identified in boxes. The unboxed sequences represent framework (FR) sequences. FIG. 15A is a sequence alignment showing the CDR 1 , CDR 2 , and CDR 3 sequences (Kabat definition) for each of the variable region sequences shown in FIG. 14A . FIG. 15B is a sequence alignment showing the CDR 1 , CDR 2 , and CDR 3 sequences (Kabat definition) for each of the variable region sequences shown in FIG. 14B . FIG. 16 is a histogram summarizing results from an experiment measuring inhibition of MSP induced HPAF-II cell migration by anti-RON antibodies Sh29B06-78 and Sh07F01-62, an IgG negative control (human IgG), and a no MSP control by transwell assay. FIG. 17 is a histogram summarizing results from an experiment measuring inhibition of MSP induced HPAF-II cell invasion by anti-RON antibodies Sh29B06-78 and Sh07F01-62 and an IgG negative control (human IgG) at 0 and 1 nM MSP. FIG. 18 is a graph summarizing data on inhibition of growth of an NCI-H358 xenograft tumor model by anti-RON antibodies mu07F01 (∘), Sh07F01-62 (▴), mu29B06 (♦), RON8 (▪), and Sh29B06-78 (●), and a human IgG control (+). FIG. 19 depicts Western blots summarizing results from an experiment measuring RON receptor degradation by anti-RON antibodies mu07F01, Sh07F01-62, mu29B06, RON8, and Sh29B06-78. DETAILED DESCRIPTION The anti-RON antibodies disclosed herein are based on the antigen binding sites of certain monoclonal antibodies that have been selected on the basis of binding and neutralizing the activity of human RON. The antibodies contain immunoglobulin variable region CDR sequences that define a binding site for human RON. In view of the neutralizing activity of these antibodies, they are useful for modulating the growth and/or proliferation of certain types of cancer cells. When used as a therapeutic agent, the antibodies can be engineered to minimize or eliminate an immune response when administered to a human patient. In some embodiments, the antibodies are fused or conjugated to other moieties, such as effector molecules (e.g., other proteins or small molecule therapeutics), a detectable label or a toxin moiety. Various features and aspects of the invention are discussed in more detail below. As used herein, unless otherwise indicated, the term “antibody” means an intact antibody (e.g., an intact monoclonal antibody) or antigen-binding fragment of an antibody (e.g., an antigen-binding fragment of a monoclonal antibody), including an intact antibody or antigen-binding fragment that has been modified, engineered or chemically conjugated, or that is a human antibody. Examples of antibodies that have been modified or engineered are chimeric antibodies, humanized antibodies, and multispecific antibodies (e.g., bispecific antibodies). Examples of antigen-binding fragments include Fab, Fab′, F(ab′) 2 , Fv, single chain antibodies (e.g., scFv), minibodies and diabodies. An antibody conjugated to a toxin moiety is an example of a chemically conjugated antibody. I. Antibodies that Bind RON The antibodies disclosed herein comprise: (a) an immunoglobulin heavy chain variable region comprising the structure CDR H1 -CDR H2 -CDR H3 and (b) an immunoglobulin light chain variable region comprising the structure CDR L1 -CDR L2 -CDR L3 , wherein the heavy chain variable region and the light chain variable region together define a single binding site for binding human RON protein. In some embodiments, the antibody comprises: (a) an immunoglobulin heavy chain variable region comprising the structure CDR H1 -CDR H2 -CDR H3 and (b) an immunoglobulin light chain variable region, wherein the heavy chain variable region and the light chain variable region together define a single binding site for binding human RON. A CDR H1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 5 (07F01), SEQ ID NO: 51 (07F01), SEQ ID NO: 124 (Sh07F01 Hv3-48 D28T T60A L63V E65G), SEQ ID NO: 15 (12B11), SEQ ID NO: 53 (12B11), SEQ ID NO: 25 (17F06), SEQ ID NO: 55 (17F06), SEQ ID NO: 35 (18H09), SEQ ID NO: 57 (18H09), SEQ ID NO: 45 (29B06), SEQ ID NO: 59 (29B06), and SEQ ID NO: 126 (Sh29B06 Hv4-59, Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F); a CDR H2 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 6 (07F01), SEQ ID NO: 16 (12B11), SEQ ID NO: 26 (17F06), SEQ ID NO: 36 (18H09), SEQ ID NO: 46 (29B06), and SEQ ID NO: 122 (Sh07F01 Hv3-48 D28T T60A L63V E65G); and a CDR H3 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:7 (07F01), SEQ ID NO: 17 (12B11), SEQ ID NO: 27 (17F06), SEQ ID NO: 37 (18H09), SEQ ID NO: 47 (29B06), and SEQ ID NO: 123 (Chimeric 07F01 C102S, Sh07F01 Hv3-48, Sh07F01 Hv3-48 D28T T60A L63V E65G). Throughout the specification a particular SEQ ID NO. is followed in parentheses by the antibody that was the origin of that sequence. For example, “SEQ ID NO: 5 (07F01)” means that SEQ ID NO: 5 comes from antibody 07F01. In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO: 5 (07F01), SEQ ID NO: 51 (07F01), or SEQ ID NO: 124 (Sh07F01 Hv3-48 D28T T60A L63V E65G); a CDR H2 comprising the amino acid sequence of SEQ ID NO: 6 (07F01) or SEQ ID NO: 122 (Sh07F01 Hv3-48 D28T T60A L63V E65G), and a CDR H3 comprising the amino acid sequence of SEQ ID NO: 7 (07F01) or SEQ ID NO: 123 (Chimeric 07F01 C102S, Sh07F01 Hv3-48, Sh07F01 Hv3-48 D28T T60A L63V E65G). In some embodiments, the heavy chain variable region comprises a CDR H1 comprising the amino acid sequence of SEQ ID NO: 5 (07F01), a CDR H2 comprising the amino acid sequence of SEQ ID NO: 122 (Sh07F01 Hv3-48 D28T T60A L63V E65G), and a CDR H3 comprising the amino acid sequence of SEQ ID NO: 123 (Chimeric 07F01 C102S, Sh07F01 Hv3-48, Sh07F01 Hv3-48 D28T T60A L63V E65G). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO: 15 (12B11) or SEQ ID NO: 53 (12B11), a CDR H2 comprising the amino acid sequence of SEQ ID NO: 16 (12B11), and a CDR H3 comprising the amino acid sequence of SEQ ID NO: 17 (12B11). In some embodiments, the heavy chain variable region comprises a CDR H1 comprising the amino acid sequence of SEQ ID NO: 25 (17F06) or SEQ ID NO: 55 (17F06), a CDR H2 comprising the amino acid sequence of SEQ ID NO: 26 (17F06), and a CDR H3 comprising the amino acid sequence of SEQ ID NO: 27 (17F06). In some embodiments, the heavy chain variable region comprises a CDR H1 comprising the amino acid sequence of SEQ ID NO: 35 (18H09) or SEQ ID NO: 57 (18H09), a CDR H2 comprising the amino acid sequence of SEQ ID NO: 36 (18H09), and a CDR H3 comprising the amino acid sequence of SEQ ID NO: 37 (18H09). In some embodiments, the heavy chain variable region comprises a CDR H1 comprising the amino acid sequence of SEQ ID NO: 45 (29B06), SEQ ID NO: 59 (29B06), or SEQ ID NO: 126 (Sh29B06 Hv4-59, Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F), a CDR H2 comprising the amino acid sequence of SEQ ID NO: 46 (29B06), and a CDR H3 comprising the amino acid sequence of SEQ ID NO: 47 (29B06). In some embodiments, the heavy chain variable region comprises a CDR H1 comprising the amino acid sequence of SEQ ID NO: 45 (29B06) or SEQ ID NO: 126 (Sh29B06 Hv4-59, Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F), a CDR H2 comprising the amino acid sequence of SEQ ID NO: 46 (29B06), and a CDR H3 comprising the amino acid sequence of SEQ ID NO: 47 (29B06). Preferably, the CDR H1 , CDR H2 , and CDR H3 sequences are interposed between human or humanized immunoglobulin FRs. The antibody can be an intact antibody or an antigen-binding antibody fragment. In some embodiments, the antibody comprises (a) an immunoglobulin light chain variable region comprising the structure CDR L1 -CDR L2 -CDR L3 , and (b) an immunoglobulin heavy chain variable region, wherein the IgG light chain variable region and the IgG heavy chain variable region together define a single binding site for binding human RON. A CDR L1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 8 (07F01), SEQ ID NO: 18 (12B11), SEQ ID NO: 28 (17F06), SEQ ID NO: 38 (18H09), SEQ ID NO: 48 (29B06), and SEQ ID NO: 130 (HE L 07F01 Kv1-9, Sh07F01 Kv1-9 F1); a CDR L2 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 9 (07F01), SEQ ID NO: 19 (12B11), SEQ ID NO: 29 (17F06), SEQ ID NO: 39 (18H09), SEQ ID NO: 49 (29B06), and SEQ ID NO: 131 (HE L 07F01 Kv1-9, Sh07F01 Kv1-9 F1); and a CDR L3 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 10 (07F01), SEQ ID NO: 20 (12B11), SEQ ID NO:30 (17F06), SEQ ID NO: 40 (18H09), and SEQ ID NO: 50 (29B06). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO: 8 (07F01) or SEQ ID NO: 130 (HE L 07F01 Kv1-9, Sh07F01 Kv1-9 F1), a CDR L2 comprising the amino acid sequence of SEQ ID NO: 9 (07F01) or SEQ ID NO: 131 (HE L 07F01 Kv1-9, Sh07F01 Kv1-9 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO: 10 (07F01). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO: 130 (HE L 07F01 Kv1-9, Sh07F01 Kv1-9 F1); a CDR L2 comprising the amino acid sequence of SEQ ID NO: 131 (HE L 07F01 Kv1-9, Sh07F01 Kv1-9 F1); and a CDR L3 comprising the amino acid sequence of SEQ ID NO: 10 (07F01). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO: 18 (12B11); a CDR L2 comprising the amino acid sequence of SEQ ID NO: 19 (12B11); and a CDR L3 comprising the amino acid sequence of SEQ ID NO: 20 (12B11). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO: 28 (17F06); a CDR L2 comprising the amino acid sequence of SEQ ID NO: 29 (17F06); and a CDR L3 comprising the amino acid sequence of SEQ ID NO: 30 (17F06). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO: 38 (18H09); a CDR L2 comprising the amino acid sequence of SEQ ID NO: 39 (18H09); and a CDR L3 comprising the amino acid sequence of SEQ ID NO: 40 (18H09). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO: 48 (29B06); a CDR L2 comprising the amino acid sequence of SEQ ID NO: 49 (29B06); and a CDR L3 comprising the amino acid sequence of SEQ ID NO: 50 (29B06). Preferably, the CDR L1 , CDR L2 , and CDR L3 sequences are interposed between human or humanized immunoglobulin FRs. The antibody can be an intact antibody or an antigen-binding antibody fragment. In some embodiments, the antibody comprises: (a) an immunoglobulin heavy chain variable region comprising the structure CDR H1 -CDR H2 -CDR H3 and (b) an immunoglobulin light chain variable region comprising the structure CDR L1 -CDR L2 -CDR L3 , wherein the heavy chain variable region and the light chain variable region together define a single binding site for binding human RON. The CDR H1 is an amino acid sequence selected from the group consisting of SEQ ID NO: 5 (07F01), SEQ ID NO: 51 (07F01), SEQ ID NO: 124 (Sh07F01 Hv3-48 D28T T60A L63V E65G), SEQ ID NO: 15 (12B11), SEQ ID NO: 53 (12B11), SEQ ID NO: 25 (17F06), SEQ ID NO: 55 (17F06), SEQ ID NO: 35 (18H09), SEQ ID NO: 57 (18H09), SEQ ID NO: 45 (29B06), SEQ ID NO: 59 (29B06), and SEQ ID NO: 126 (Sh29B06 Hv4-59, Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F); the CDR H2 is an amino acid sequence selected from the group consisting SEQ ID NO: 6 (07F01), SEQ ID NO: 16 (12B11), SEQ ID NO: 26 (17F06), SEQ ID NO: 36 (18H09), SEQ ID NO: 46 (29B06), and SEQ ID NO: 122 (Sh07F01 Hv3-48 D28T T60A L63V E65G); and the CDR H3 is an amino acid sequence selected from the group consisting of SEQ ID NO:7 (07F01), SEQ ID NO: 17 (12B11), SEQ ID NO: 27 (17F06), SEQ ID NO: 37 (18H09), SEQ ID NO: 47 (29B06), and SEQ ID NO: 123 (Chimeric 07F01 C102S, Sh07F01 Hv3-48, Sh07F01 Hv3-48 D28T T60A L63V E65G). The CDR L1 is an amino acid sequence selected from the group consisting of SEQ ID NO: 8 (07F01), SEQ ID NO: 18 (12B11), SEQ ID NO: 28 (17F06), SEQ ID NO: 38 (18H09), SEQ ID NO: 48 (29B06), and SEQ ID NO: 130 (HE L 07F01 Kv1-9, Sh07F01 Kv1-9 F1); the CDR L2 is an amino acid sequence selected from the group consisting of SEQ ID NO: 9 (07F01), SEQ ID NO: 19 (12B11), SEQ ID NO: 29 (17F06), SEQ ID NO: 39 (18H09), SEQ ID NO: 49 (29B06), and SEQ ID NO: 131 (HE L 07F01 Kv1-9, Sh07F01 Kv1-9 F1); and the CDR L3 is an amino acid sequence selected from the group consisting of SEQ ID NO: 10 (07F01), SEQ ID NO: 20 (12B11), SEQ ID NO: 30 (17F06), SEQ ID NO: 40 (18H09), and SEQ ID NO: 50 (29B06). The antibodies disclosed herein comprise an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region. In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region selected from the group consisting of SEQ ID NO: 2 (07F01), SEQ ID NO: 12 (12B11), SEQ ID NO: 22 (17F06), SEQ ID NO: 32 (18H09), SEQ ID NO: 42 (29B06), SEQ ID NO: 133 (Chimeric 07F01 C102S), SEQ ID NO: 135 (Sh07F01 Hv3-48), SEQ ID NO: 137 (Sh07F01 Hv3-48 D28T T60A L63V E65G), SEQ ID NO: 143 (Sh29B06 Hv4-59), SEQ ID NO: 145 (Hu29B06 Hv4-59), and SEQ ID NO: 147 (Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F), and an immunoglobulin light chain variable region. In other embodiments, the antibody comprises an immunoglobulin light chain variable region selected from the group consisting of SEQ ID NO: 4 (07F01), SEQ ID NO: 14 (12B11), SEQ ID NO: 24 (17F06), SEQ ID NO: 34 (18H09), SEQ ID NO: 44 (29B06), SEQ ID NO: 139 (HE L 07F01 Kv1-9), SEQ ID NO: 141 (Sh07F01 Kv1-9 F1), and SEQ ID NO: 149 (Sh29B06 Kv2-28), and an immunoglobulin heavy chain variable region. In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region selected from the group consisting of SEQ ID NO: 2 (07F01), SEQ ID NO: 12 (12B11), SEQ ID NO: 22 (17F06), SEQ ID NO: 32 (18H09), SEQ ID NO: 42 (29B06), SEQ ID NO: 133 (Chimeric 07F01 C102S), SEQ ID NO: 135 (Sh07F01 Hv3-48), SEQ ID NO: 137 (Sh07F01 Hv3-48 D28T T60A L63V E65G), SEQ ID NO: 143 (Sh29B06 Hv4-59), SEQ ID NO: 145 (Hu29B06 Hv4-59), and SEQ ID NO: 147 (Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F), and an immunoglobulin light chain variable region selected from the group consisting of SEQ ID NO: 4 (07F01), SEQ ID NO: 14 (12B11), SEQ ID NO: 24 (17F06), SEQ ID NO: 34 (18H09), SEQ ID NO: 44 (29B06), SEQ ID NO: 139 (HE L 07F01 Kv1-9), SEQ ID NO: 141 (Sh07F01 Kv1-9 F1), and SEQ ID NO: 149 (Sh29B06 Kv2-28). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2 (07F01), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 4 (07F01). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 12 (12B11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 14 (12B11). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 22 (17F06), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 24 (17F06). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 32 (18H09), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 34 (18H09). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 42 (29B06), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 44 (29B06). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 137 (Sh07F01 Hv3-48 D28T T60A L63V E65G), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 139 (HE L 07F01 Kv1-9). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 147 (Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 149 (Sh29B06 Kv2-28). In certain embodiments, the antibodies disclosed herein comprise an immunoglobulin heavy chain and an immunoglobulin light chain. In some embodiments, the antibody comprises an immunoglobulin heavy chain selected from the group consisting of SEQ ID NO: 93 (07F01), SEQ ID NO: 97 (12B11), SEQ ID NO: 101 (17F06), SEQ ID NO: 105 (18H09), SEQ ID NO: 109 (29B06), SEQ ID NO: 156 (Chimeric 07F01 C102S IgG1), SEQ ID NO: 160 (Chimeric 29B06 IgG1), SEQ ID NO: 164 (Sh07F01 Hv3-48 IgG1), SEQ ID NO: 166 (Sh07F01 Hv3-48 D28T T60A L63V E65G IgG1), SEQ ID NO: 172 (Sh29B06 Hv4-59 IgG1), SEQ ID NO: 174 (Hu29B06 Hv4-59 IgG1), and SEQ ID NO: 176 (Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F IgG1), and an immunoglobulin light chain. In other embodiments, the antibody comprises an immunoglobulin light chain selected from the group consisting of SEQ ID NO: 95 (07F01), SEQ ID NO: 99 (12B11), SEQ ID NO: 103 (17F06), SEQ ID NO: 107 (18H09), SEQ ID NO: 111 (29B06), SEQ ID NO: 158 (Chimeric 07F01 Kappa), SEQ ID NO: 162 (Chimeric 29B06 Kappa), SEQ ID NO: 168 (HE L 07F01 Kv1-9 Kappa), SEQ ID NO: 170 (Sh07F01 Kv1-9 F1 Kappa), and SEQ ID NO: 178 (Sh29B06 Kv2-28 Kappa), and an immunoglobulin heavy chain. In some embodiments, the antibody comprises (i) an immunoglobulin heavy chain selected from the group consisting of SEQ ID NO: 93 (07F01), SEQ ID NO: 97 (12B11), SEQ ID NO: 101 (17F06), SEQ ID NO: 105 (18H09), SEQ ID NO: 109 (29B06), SEQ ID NO: 156 (Chimeric 07F01 C102S IgG1), SEQ ID NO: 160 (Chimeric 29B06 IgG1), SEQ ID NO: 164 (Sh07F01 Hv3-48 IgG1), SEQ ID NO: 166 (Sh07F01 Hv3-48 D28T T60A L63V E65G IgG1), SEQ ID NO: 172 (Sh29B06 Hv4-59 IgG1), SEQ ID NO: 174 (Hu29B06 Hv4-59 IgG1), and SEQ ID NO: 176 (Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F IgG1), and (ii) an immunoglobulin light chain selected from the group consisting of SEQ ID NO: 95 (07F01), SEQ ID NO: 99 (12B11), SEQ ID NO: 103 (17F06), SEQ ID NO: 107 (18H09), SEQ ID NO: 111 (29B06), SEQ ID NO: 158 (Chimeric 07F01 Kappa), SEQ ID NO: 162 (Chimeric 29B06 Kappa), SEQ ID NO: 168 (HE L 07F01 Kv1-9 Kappa), SEQ ID NO: 170 (Sh07F01 Kv1-9 F1 Kappa), and SEQ ID NO: 178 (Sh29B06 Kv2-28 Kappa). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 93 (07F01), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 95 (07F01). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 97 (12B11), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 99 (12B11). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 101 (17F06), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 103 (17F06). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 105 (18H09), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 107 (18H09). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 109 (29B06), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 111 (29B06). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 166 (Sh07F01 Hv3-48 D28T T60A L63V E65G IgG1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 168 (HE L 07F01 Kv1-9 Kappa). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO: 176 (Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F IgG1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO: 178 (Sh29B06 Kv2-28 Kappa). In certain embodiments, an isolated antibody that binds human RON comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the entire variable region or the framework region sequence of SEQ ID NO: 2 (07F01), SEQ ID NO: 12 (12B11), SEQ ID NO: 22 (17F06), SEQ ID NO: 32 (18H09), SEQ ID NO: 42 (29B06), SEQ ID NO: 133 (Chimeric 07F01 C102S), SEQ ID NO: 135 (Sh07F01 Hv3-48), SEQ ID NO: 137 (Sh07F01 Hv3-48 D28T T60A L63V E65G), SEQ ID NO: 143 (Sh29B06 Hv4-59), SEQ ID NO: 145 (Hu29B06 Hv4-59), or SEQ ID NO: 147 (Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F). In certain embodiments, an isolated antibody that binds human RON comprises an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the entire variable region or the framework region sequence of SEQ ID NO: 4 (07F01), SEQ ID NO: 14 (12B11), SEQ ID NO: 24 (17F06), SEQ ID NO: 34 (18H09), SEQ ID NO: 44 (29B06), SEQ ID NO: 139 (HE L 07F01 Kv1-9), SEQ ID NO: 141 (Sh07F01 Kv1-9 F1), or SEQ ID NO: 149 (Sh29B06 Kv2-28). Homology or identity may be determined in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. BLAST (Basic Local Alignment Search Tool) analysis using the algorithm employed by the programs blastp, blastn, blastx, tblastn and tblastx (Karlin et al., (1990) P ROC . N ATL . A CAD . S CI . USA 87, 2264-2268; Altschul, (1993) J. M OL . E VOL . 36, 290-300; Altschul et al., (1997) N UCLEIC A CIDS R ES. 25, 3389-3402, incorporated by reference) are tailored for sequence similarity searching. The approach used by the BLAST program is to first consider similar segments between a query sequence and a database sequence, then to evaluate the statistical significance of all matches that are identified and finally to summarize only those matches which satisfy a preselected threshold of significance. For a discussion of basic issues in similarity searching of sequence databases see Altschul et al., (1994) N ATURE G ENETICS 6, 119-129 which is fully incorporated by reference. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. The search parameters for histogram, descriptions, alignments, expect (i.e., the statistical significance threshold for reporting matches against database sequences), cutoff, matrix and filter are at the default settings. The default scoring matrix used by blastp, blastx, tblastn, and tblastx is the BLOSUM62 matrix (Henikoff et al., (1992) P ROC . N ATL . A CAD . S CI . USA 89, 10915-10919, fully incorporated by reference). Four blastn parameters may be adjusted as follows: Q=10 (gap creation penalty); R=10 (gap extension penalty); wink=1 (generates word hits at every wink.sup.th position along the query); and gapw=16 (sets the window width within which gapped alignments are generated). The equivalent Blastp parameter settings may be Q=9; R=2; wink=1; and gapw=32. Searches may also be conducted using the NCBI (National Center for Biotechnology Information) BLAST Advanced Option parameter (e.g.: -G, Cost to open gap [Integer]: default=5 for nucleotides/11 for proteins; -E, Cost to extend gap [Integer]: default=2 for nucleotides/1 for proteins; -q, Penalty for nucleotide mismatch [Integer]: default=−3; -r, reward for nucleotide match [Integer]: default=1; -e, expect value [Real]: default=10; -W, wordsize [Integer]: default=11 for nucleotides/28 for megablast/3 for proteins; -y, Dropoff (X) for blast extensions in bits: default=20 for blastn/7 for others; -X, X dropoff value for gapped alignment (in bits): default=15 for all programs, not applicable to blastn; and -Z, final X dropoff value for gapped alignment (in bits): 50 for blastn, 25 for others). ClustalW for pairwise protein alignments may also be used (default parameters may include, e.g., Blosum62 matrix and Gap Opening Penalty=10 and Gap Extension Penalty=0.1). A Bestfit comparison between sequences, available in the GCG package version 10.0, uses DNA parameters GAP=50 (gap creation penalty) and LEN=3 (gap extension penalty) and the equivalent settings in protein comparisons are GAP=8 and LEN=2. In each of the foregoing embodiments, it is contemplated herein that immunoglobulin heavy chain variable region sequences and/or light chain variable region sequences that together bind human RON may contain amino acid alterations (e.g., at least 1, 2, 3, 4, 5, or 10 amino acid substitutions, deletions, or additions) in the framework regions of the heavy and/or light chain variable regions. In certain embodiments, the antibody binds human RON with a K D of 1 nM, 900 pM, 750 pM, 650 pM, 600 pM, 500 pM, 400 pM, 300 pM, 250 pM, 200 pM, 150 pM, 100 pM, 50 pM or lower. Unless otherwise specified, K D values are determined by surface plasmon resonance methods under the conditions described in Examples 5 and 14. Antibody Sh29B06-78 binds human RON with a K D of 500 pM, 250 pM, 200 pM, 150 pM, 100 pM or lower as measured by surface plasmon resonance methods under the conditions described in Examples 5 and 14. In an exemplary embodiment, antibody Sh29B06-78 binds human RON with a K D of 150 pM or lower as measured by surface plasmon resonance methods at 37° C. under the conditions described in Examples 5 and 14. Antibody SH07F01-62 binds human RON with a K D of 500 pM, 400 pM, 350 pM, 300 pM, 250 pM, 200 pM, 150 pM, 100 pM or lower as measured by surface plasmon resonance methods under the conditions described in Examples 5 and 14. In an exemplary embodiment, antibody SH07F01-62 binds human RON with a K D of 250 pM to 350 pM or lower as measured by surface plasmon resonance methods at 37° C. under the conditions described in Examples 5 and 14. In certain embodiments, the antibodies inhibit human MSP binding to human RON. For example, the antibodies can have an IC 50 (concentration at 50% of maximum inhibition) of about 5 nM, 2 nM, 1 nM or lower, when assayed using the protocol described in Examples 8 and 15. Although the embodiments illustrated in the Examples comprise pairs of variable regions, pairs of full length antibody chains, or pairs of CDR1, CDR2 and CDR3 regions, one from a heavy chain and one from a light chain, a skilled artisan will recognize that alternative embodiments may comprise single heavy chain variable regions or single light chain variable regions, single full length antibody chains, or CDR1, CDR2 and CDR3 regions from one antibody chain, either heavy or light. The single variable region, full length antibody chain or CDR1, CDR2 and CDR3 region of one chain can be used to screen for corresponding domains in another chain, the two chains capable of forming an antibody that binds antigen. The screening may be accomplished by phage display screening methods using, e.g., a hierarchical dual combinatorial approach disclosed in PCT Publ. No. WO92/01047. In this approach, an individual colony containing either a heavy or light chain clone is used to infect a complete library of clones encoding the other chain (light or heavy), and the resulting two-chain specific antigen-binding domain is selected in accordance with phage display techniques as described. II. Production of Antibodies Methods for producing antibodies, such as those disclosed herein, are known in the art. For example, DNA molecules encoding light chain variable regions and/or heavy chain variable regions can be chemically synthesized using the sequence information provided herein. Synthetic DNA molecules can be ligated to other appropriate nucleotide sequences, including, e.g., constant region coding sequences, and expression control sequences, to produce conventional gene expression constructs encoding the desired antibodies. Production of defined gene constructs is within routine skill in the art. Alternatively, the sequences provided herein can be cloned out of hybridomas by conventional hybridization techniques or polymerase chain reaction (PCR) techniques, using synthetic nucleic acid probes whose sequences are based on sequence information provided herein, or prior art sequence information regarding genes encoding the heavy and light chains of murine antibodies in hybridoma cells. Nucleic acids encoding desired antibodies can be incorporated (ligated) into expression vectors, which can be introduced into host cells through conventional transfection or transformation techniques. Exemplary host cells are E. coli cells, Chinese hamster ovary (CHO) cells, human embryonic kidney 293 (HEK 293) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), and myeloma cells that do not otherwise produce IgG protein. Transformed host cells can be grown under conditions that permit the host cells to express the genes that encode the immunoglobulin light and/or heavy chain variable regions. Specific expression and purification conditions will vary depending upon the expression system employed. For example, if a gene is to be expressed in E. coli , it is first cloned into an expression vector by positioning the engineered gene downstream from a suitable bacterial promoter, e.g., Trp or Tac, and a prokaryotic signal sequence. The expressed secreted protein accumulates in refractile or inclusion bodies, and can be harvested after disruption of the cells by French press or sonication. The refractile bodies then are solubilized, and the proteins refolded and cleaved by methods known in the art. If the engineered gene is to be expressed in eukayotic host cells, e.g., CHO cells, it is first inserted into an expression vector containing a suitable eukaryotic promoter, a secretion signal, IgG enhancers, and various introns. This expression vector optionally contains sequences encoding all or part of a constant region, enabling an entire, or a part of, a heavy or light chain to be expressed. The gene construct can be introduced into eukaryotic host cells using conventional techniques. The host cells express V L or V H fragments, V L -V H heterodimers, V H -V L or V L -V H single chain polypeptides, complete heavy or light immunoglobulin chains, or portions thereof, each of which may be attached to a moiety having another function (e.g., cytotoxicity). In some embodiments, a host cell is transfected with a single vector expressing a polypeptide expressing an entire, or part of, a heavy chain (e.g., a heavy chain variable region) or a light chain (e.g., a light chain variable region). In other embodiments, a host cell is transfected with a single vector encoding (a) a polypeptide comprising a heavy chain variable region and a polypeptide comprising a light chain variable region, or (b) an entire immunoglobulin heavy chain and an entire immunoglobulin light chain. In still other embodiments, a host cell is co-transfected with more than one expression vector (e.g., one expression vector expressing a polypeptide comprising an entire, or part of, a heavy chain or heavy chain variable region, and another expression vector expressing a polypeptide comprising an entire, or part of, a light chain or light chain variable region). A polypeptide comprising an immunoglobulin heavy chain variable region or light chain variable region can be produced by growing a host cell transfected with an expression vector encoding such variable region, under conditions that permit expression of the polypeptide. Following expression, the polypeptide can be harvested and purified using techniques well known in the art, e.g., affinity tags such as glutathione-S-transferase (GST) and histidine tags. A monoclonal antibody that binds human RON, or an antigen-binding fragment of the antibody, can be produced by growing a host cell transfected with: (a) an expression vector that encodes a complete or partial immunoglobulin heavy chain, and a separate expression vector that encodes a complete or partial immunoglobulin light chain; or (b) a single expression vector that encodes both chains (e.g., complete or partial heavy and light chains), under conditions that permit expression of both chains. The intact antibody (or antigen-binding fragment) can be harvested and purified using techniques well known in the art, e.g., Protein A, Protein G, affinity tags such as glutathione-S-transferase (GST) and histidine tags. It is within ordinary skill in the art to express the heavy chain and the light chain from a single expression vector or from two separate expression vectors. III. Antibody Modifications Methods for reducing or eliminating the antigenicity of antibodies and antibody fragments are known in the art. When the antibodies are to be administered to a human, the antibodies preferably are “humanized” to reduce or eliminate antigenicity in humans. Preferably, the humanized antibodies have the same or substantially the same affinity for the antigen as the non-humanized mouse antibody from which it was derived. In one humanization approach, chimeric proteins are created in which mouse immunoglobulin constant regions are replaced with human immunoglobulin constant regions. See, e.g., Morrison et al., 1984, P ROC . N AT . A CAD . S CI. 81:6851-6855, Neuberger et al., 1984, N ATURE 312:604-608; U.S. Pat. No. 6,893,625 (Robinson); U.S. Pat. No. 5,500,362 (Robinson); and U.S. Pat. No. 4,816,567 (Cabilly). In an approach known as CDR grafting, the CDRs of the light and heavy chain variable regions are grafted into frameworks from another species. For example, murine CDRs can be grafted into human FRs. In some embodiments, the CDRs of the light and heavy chain variable regions of an anti-RON antibody are grafted into human FRs or consensus human FRs. To create consensus human FRs, FRs from several human heavy chain or light chain amino acid sequences are aligned to identify a consensus amino acid sequence. CDR grafting is described in U.S. Pat. No. 7,022,500 (Queen); U.S. Pat. No. 6,982,321 (Winter); U.S. Pat. No. 6,180,370 (Queen); U.S. Pat. No. 6,054,297 (Carter); U.S. Pat. No. 5,693,762 (Queen); U.S. Pat. No. 5,859,205 (Adair); U.S. Pat. No. 5,693,761 (Queen); U.S. Pat. No. 5,565,332 (Hoogenboom); U.S. Pat. No. 5,585,089 (Queen); U.S. Pat. No. 5,530,101 (Queen); Jones et al. (1986) N ATURE 321: 522-525; Riechmann et al. (1988) N ATURE 332: 323-327; Verhoeyen et al. (1988) S CIENCE 239: 1534-1536; and Winter (1998) F EBS L ETT 430: 92-94. In an approach called “SUPERHUMANIZATION™,” human CDR sequences are chosen from human germline genes, based on the structural similarity of the human CDRs to those of the mouse antibody to be humanized. See, e.g., U.S. Pat. No. 6,881,557 (Foote); and Tan et al., 2002, J. I MMUNOL. 169:1119-1125. Other methods to reduce immunogenicity include “reshaping,” “hyperchimerization,” and “veneering/resurfacing.” See, e.g., Vaswami et al., 1998, A NNALS OF A LLERGY , A STHMA , & I MMUNOL. 81:105; Roguska et al., 1996, P ROT . E NGINEER 9:895-904; and U.S. Pat. No. 6,072,035 (Hardman). In the veneering/resurfacing approach, the surface accessible amino acid residues in the murine antibody are replaced by amino acid residues more frequently found at the same positions in a human antibody. This type of antibody resurfacing is described, e.g., in U.S. Pat. No. 5,639,641 (Pedersen). Another approach for converting a mouse antibody into a form suitable for medical use in humans is known as ACTIVMAB™ technology (Vaccinex, Inc., Rochester, N.Y.), which involves a vaccinia virus-based vector to express antibodies in mammalian cells. High levels of combinatorial diversity of IgG heavy and light chains are said to be produced. See, e.g., U.S. Pat. No. 6,706,477 (Zauderer); U.S. Pat. No. 6,800,442 (Zauderer); and U.S. Pat. No. 6,872,518 (Zauderer). Another approach for converting a mouse antibody into a form suitable for use in humans is technology practiced commercially by KaloBios Pharmaceuticals, Inc. (Palo Alto, Calif.). This technology involves the use of a proprietary human “acceptor” library to produce an “epitope focused” library for antibody selection. Another approach for modifying a mouse antibody into a form suitable for medical use in humans is HUMAN ENGINEERING™ technology, which is practiced commercially by XOMA (US) LLC. See, e.g., PCT Publication No. WO 93/11794 and U.S. Pat. No. 5,766,886 (Studnicka); U.S. Pat. No. 5,770,196 (Studnicka); U.S. Pat. No. 5,821,123 (Studnicka); and U.S. Pat. No. 5,869,619 (Studnicka). Any suitable approach, including any of the above approaches, can be used to reduce or eliminate human immunogenicity of an antibody. In addition, it is possible to create fully human antibodies in mice. Fully human mAbs lacking any non-human sequences can be prepared from human immunoglobulin transgenic mice by techniques referenced in, e.g., Lonberg et al., N ATURE 368:856-859, 1994; Fishwild et al., N ATURE B IOTECHNOLOGY 14:845-851, 1996; and Mendez et al., N ATURE G ENETICS 15:146-156, 1997. Human mAbs can also be prepared and optimized from phage display libraries by techniques referenced in, e.g., Knappik et al., J. M OL . B IOL. 296:57-86, 2000; and Krebs et al., J. Immunol. Meth. 254:67-84 2001). If the antibody is for use as a therapeutic, it can be conjugated to an effector agent such as a small molecule toxin or a radionuclide using standard in vitro conjugation chemistries. If the effector agent is a polypeptide, the antibody can be chemically conjugated to the effector or joined to the effector as a fusion protein. Construction of fusion proteins is within ordinary skill in the art. IV. Use of Antibodies The antibodies disclosed herein can be used to treat various forms of cancer, e.g., non-small cell lung cancer, breast, ovarian, prostate, cervical, colorectal, lung, pancreatic, gastric, and head and neck cancers. The cancer cells are exposed to a therapeutically effective amount of the antibody so as to inhibit or reduce proliferation of the cancer cell. In some embodiments, the antibodies inhibit cancer cell proliferation by at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%. In some embodiments, the antibody (e.g., 07F01, 29B06, 17F06, 18H09, 12B11, sh29B06, sh07F01) inhibits or reduces proliferation of a tumor cell by inhibiting binding of human RON to its ligand, MSP. In some embodiments, the antibody (e.g., 07F01, 29B06, 17F06, 18H09, 12B11, sh29B06, sh07F01) inhibits or reduces proliferation of a tumor cell without inhibiting RON binding to MSP. The antibody (e.g., 07F01, 29B06, 17F06, 18H09, 12B11, sh29B06, sh07F01) can also be used in therapy. The antibody (e.g., 07F01, 29B06, 17F06, 18H09, 12B11, sh29B06, sh07F01) can be used to inhibit tumor growth in a mammal (e.g., a human patient). In some embodiments, use of the antibody to inhibit tumor growth in a mammal comprises administering to the mammal a therapeutically effective amount of the antibody. In certain embodiments, antibody Sh29B06-78 is used in therapy. For example, antibody Sh29B06-78 can be used for inhibiting or reducing proliferation of a tumor cell. Antibody Sh29B06-78 can also be used for inhibiting or reducing tumor growth in a mammal. In other embodiments, antibody Sh07F01-62 is used in therapy. For example, antibody Sh07F01-62 can be used for inhibiting or reducing proliferation of a tumor cell. Antibody Sh07F01-62 can also be used for inhibiting or reducing tumor growth in a mammal. Cancers associated with overexpression or inappropriate activation of RON include non-small cell lung cancer, breast cancer, ovarian cancer, prostate cancer, lung cancer, colorectal cancer, pancreatic cancer, bladder cancer, and some forms of brain cancer, melanomas, and gastrointestinal cancers. As used herein, “treat,” “treating” and “treatment” mean the treatment of a disease in a mammal, e.g., in a human. This includes: (a) inhibiting the disease, i.e., arresting its development; and (b) relieving the disease, i.e., causing regression of the disease state. Generally, a therapeutically effective amount of active component is in the range of 0.1 mg/kg to 100 mg/kg, e.g., 1 mg/kg to 100 mg/kg, 1 mg/kg to 10 mg/kg. The amount administered will depend on variables such as the type and extent of disease or indication to be treated, the overall health of the patient, the in vivo potency of the antibody, the pharmaceutical formulation, and the route of administration. The initial dosage can be increased beyond the upper level in order to rapidly achieve the desired blood-level or tissue level. Alternatively, the initial dosage can be smaller than the optimum, and the dosage may be progressively increased during the course of treatment. Human dosage can be optimized, e.g., in a conventional Phase I dose escalation study designed to run from 0.5 mg/kg to 20 mg/kg. Dosing frequency can vary, depending on factors such as route of administration, dosage amount and the disease being treated. Exemplary dosing frequencies are once per day, once per week and once every two weeks. In some embodiments, dosing is once every two weeks. A preferred route of administration is parenteral, e.g., intravenous infusion. Formulation of monoclonal antibody-based drugs is within ordinary skill in the art. In some embodiments, the antibody is lyophilized and reconstituted in buffered saline at the time of administration. For therapeutic use, an antibody preferably is combined with a pharmaceutically acceptable carrier. As used herein, “pharmaceutically acceptable carrier” means buffers, carriers, and excipients suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. The carrier(s) should be “acceptable” in the sense of being compatible with the other ingredients of the formulations and not deleterious to the recipient. Pharmaceutically acceptable carriers include buffers, solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is known in the art. Pharmaceutical compositions containing antibodies, such as those disclosed herein, can be presented in a dosage unit form and can be prepared by any suitable method. A pharmaceutical composition should be formulated to be compatible with its intended route of administration. Examples of routes of administration are intravenous (IV), intradermal, inhalation, transdermal, topical, transmucosal, and rectal administration. A preferred route of administration for monoclonal antibodies is IV infusion. Useful formulations can be prepared by methods well known in the pharmaceutical art. For example, see Remington's Pharmaceutical Sciences, 18th ed. (Mack Publishing Company, 1990). Formulation components suitable for parenteral administration include a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as EDTA; buffers such as acetates, citrates or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). The carrier should be stable under the conditions of manufacture and storage, and should be preserved against microorganisms. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol), and suitable mixtures thereof. Pharmaceutical formulations preferably are sterile. Sterilization can be accomplished, for example, by filtration through sterile filtration membranes. Where the composition is lyophilized, filter sterilization can be conducted prior to or following lyophilization and reconstitution. EXAMPLES The following Examples are merely illustrative and are not intended to limit the scope or content of the invention in any way. Example 1 Production of Human RON Extracellular Domain (ECD) This Example describes the production of the antigen, hRON ECD protein. The use of the full length ECD as the immunogen, allowed for the selection of two classes of hybridomas: (a) those producing antibodies that interact with the ligand binding domain, thereby inhibiting contact of the ligand to the receptor; and (b) those producing antibodies that bind outside the ligand binding domain, thereby inhibiting the receptor functions through mechanisms other than inhibition of ligand binding. DNA encoding the extracellular domain of human RON (hRON ECD) (ref seq. NM — 002447) was amplified by PCR and subcloned using the XmaI/EcoRI restriction sites in-frame into the pEE14.4 vector (Lonza, Basel, Switzerland) containing THXmFC (Thrombin/His tag/Factor Xa-AJ mouse IgG-Fc), to produce a fusion protein. The resulting clone was linearized using the PvuI enzyme (NEBiolabs, Cat. No. R0150), then electroporated into CHO K1SVcells (Lonza). The electroporated cells were diluted in 200 ml CD CHO media (Gibco Cat. No. 10743-011). The next day, CD CHO media containing methionine sulfoximine (MSX) for a final concentration of 50 μM was added to the cells. After four weeks, positive clones were selected by sandwich ELISA in which the immobilized antibody was commercial monoclonal anti-hRON antibody MAB691 (R&D Systems), and the detection antibody was commercial polyclonal anti-hRON antibody AF691 (R&D Systems). Positive clones were re-transfected using LIPOFECTAMINE™ 2000 in a standard protocol. Cells were aliquoted into four separate shaker flasks and selected using 50 uM, 100 uM, 200 uM, and 400 uM MSX. After two weeks of selection, the individual flasks were checked for hRON-ECD protein expression by ELISA. The highest selection pressure, 400 μM MSX, yielded good protein expression and was chosen for scale-up and purification. Cells were grown for 2 weeks at 37° C. in BELLOCELL® Bottles (Bellco Glass, Vineland, N.J.) at a concentration of 2-2.5×10 6 cells/ml in CD CHO media, with a final concentration of 80 μM MSX for protein production. The resulting cells were spun down in 500 ml conical tubes for 15 minutes. The supernatant was filtered using vacuum filtration using a 0.45 micron filter and then a 0.22 micron filter. The protein was then batch bound to PROSEP®-A beads (Millipore) at 4° C. overnight with rotation after adjusting the pH to 7.5. The beads were washed with 1×PBS and loaded onto disposable protein A affinity columns (Bio-Rad ECONO-PAC® columns; Bio-Rad cat. No. 732-1010). The beads were washed with 10 column volumes (CV) of glycine binding buffer (3M glycine ph 9.0, 1M NaCl). The protein was then eluted off the column using 5-10 CV of 200 mM glycine pH 2.5 acid elution buffer. The samples were then neutralized using 1.3 mL of 1.0 M Tris pH 8.0 neutralization buffer concentrated using VIVASPIN® concentrators (Sartorius Stedim Biotech). Example 2 Anti-RON Antibodies This Example describes the production of anti-hRON monoclonal antibodies. Immunizations, fusions, and primary screens were conducted at Maine Biotechnology Services Inc. (Portland, Me.), following the Repetitive Immunization Multiple Sites (RIMMS) protocol. Five AJ mice and five Balb/c mice were immunized with recombinant human RON extracellular domain (hRON-ECD). Two Balb/c mice with sera displaying the highest anti-RON activity by Enzyme Linked Immunosorbent Assay (ELISA) were chosen for subsequent fusion. Spleens and lymph nodes from the appropriate mice were harvested. B-cells were harvested and fused with a myeloma line. Fusion products were serially diluted onto forty 96-well plates to near clonality. Approximately 4,000 supernatants from the cell fusions were screened by ELISA for binding to recombinant hRON-ECD. A total of 158 supernatants containing antibodies against RON were further characterized by in vitro biochemical and cell-based assays, as described below. A panel of hybridomas was selected, subcloned and expanded. Hybridoma cell lines were transferred to BioXCell (West Lebanon, N.H.) for antibody expression and purification by affinity chromatography on Protein G resin, under standard conditions. Example 3 Screening Assays A biochemical assay was carried out to identify antibodies that inhibit ligand binding. A cell-based assay was carried out to identify antibodies that inhibit MSP induced phosphoERK downstream signaling of the receptor. Antibodies that inhibited RON mediated cellular signaling were selected for further characterization regardless of whether they blocked ligand binding in the neutralization assay. The biochemical neutralization assay measures inhibition of MSP binding to hRON by antibodies in hybridoma supernatants, using electrochemiluminescence (ECL). MA2400 96-well high binding plates (Meso Scale Discovery) were coated with 25 μl of 0.42 μg/mL hRON SEMA+PSI (an N-terminal portion of the ECD of hRON; R&D Systems) in PBS for one hour at room temperature with agitation. The plates were washed four times with PBS+0.1% TWEEN-20™ (PBST), and blocked with 150 μl of charcoal-stripped fetal bovine serum (FBS) (Gibco). The hybridoma supernatant were added and incubated for 45 minutes at room temperature. After incubation, 5 μl of MSP (3 μg/mL) in charcoal stripped FBS was added to each well, and incubated for 45 minutes. The plate was washed four times with PBST, and 25 μl of 1 μg/mL biotinylated anti-MSP antibody (R&D Systems) was added to the plates for one hour at room temperature with agitation. The plates were washed four times with PBST, and incubated with 25 μl of 1 μg/mL ST-streptavidin (Meso Scale Discovery) for one hour at room temperature with agitation. The plates were washed four times with PBST, and 150 μl read buffer (Meso Scale Discovery) was added to each well before the plates were analyzed on a SECTOR® IMAGER 2400 (Meso Scale Discovery) instrument. Antibodies 07F01, 18H09 and 29B06 each blocked MSP binding to hRON SEMA+PSI in this neutralization assay. In the cell-based assay, antibodies in the hybridoma supernatant were tested for inhibition of MSP-induced phosphorylation of ERK, which is a RON downstream signaling molecule. T47D cells were cultured in 96-well plates in RPMI 1640+10% FBS+insulin. Medium was removed, and cells were incubated in serum-free medium for 24 hours. Hybridoma supernatants containing RON antibodies were added to the cells at a dilution of 1:4 in-serum-free medium, and incubated for one hour at 37° C. MSP (5 nM) was added to the wells and incubated for 15 minutes. Medium was removed, and cells were fixed in 4% paraformaldehyde (PFA) in PBS. Total ERK and phospho-ERK were measured according to the vendor's instructions (R&D Systems, DY1018). Antibodies 07F01, 12B11, 17F06, 18H09 and 29B06 each inhibited MSP induced ERK phosphorylation in T47D cells. As discussed herein (see Examples 8 and 9), antibodies 07F01, 12B11, 17F06, 18H09 and 29B06 each inhibited MSP induced ERK phosphorylation in T47D cells, while only antibodies 07F01, 18H09 and 29B06 each blocked MSP binding to hRON SEMA+PSI in the neutralization assay. This suggests that antibodies 12B11 and 17F06 do not neutralize binding of MSP to the hRON SEMA+PSI domain, neutralize binding of MSP to RON in the context of the full RON extracellular domain, or function by a mechanism other than blocking MSP binding to RON. Example 4 Antibody Sequence Analysis The light chain isotype and heavy chain isotype of each monoclonal antibody in Example 2 was determined using the ISOSTRIP™ Mouse Monoclonal Antibody Isotyping Kit according the kit vendor's instructions (Roche Applied Science, Indianapolis, Ind.). All antibodies were found to be kappa or lambda light chain and IgG1 or IgG2a heavy chain. The heavy and light chain variable regions of the mouse monoclonal antibodies were sequenced using 5′ RACE (Rapid Amplification of cDNA Ends). Total RNA was extracted from each monoclonal hybridoma cell line using the RNEASY® Miniprep kit according to the kit vendor's instructions (Qiagen, Valencia, Calif.). Full-length first strand cDNA containing 5′ ends was generated using either the GENERACER™ Kit (Invitrogen, Carlsbad, Calif.) or SMARTER™ RACE cDNA Amplification Kit (Clontech, Mountain View, Calif.) according to the kit vendor's instructions using random primers for 5′ RACE. The variable regions of the light (kappa or lambda) and heavy (IgG1 or IgG2b) chains were amplified by PCR, using KOD Hot Start Polymerase (EMD Chemicals, Gibbstown, N.J.), Expand High Fidelity PCR System (Roche Applied Science), or Advantage 2 Polymerase Mix (Clontech) according to the kit vendor's instructions. For amplification of 5′ cDNA ends in conjunction with the GENERACER™ Kit, the GENERACER™ 5′ Primer, 5′ cgactggagcacgaggacactga 3′ (SEQ ID NO: 112) (Invitrogen) was used as a 5′ primer. For amplification of 5′ cDNA ends in conjunction with the SMARTER™ RACE cDNA Amplification Kit, the Universal Primer Mix A primer (Clontech), a mix of: 5′ CTAATACGACTCACTATAGGGCAAGCAGTGGTATCAACGCAGAGT 3′ (SEQ ID NO: 113) and 5′ CTAATACGACTCACTATAGGGC 3′ (SEQ ID NO: 114), was used as a 5′ primer. Heavy chain variable regions were amplified using the above 5′ primers and a 3′ IgG1 constant region specific primer, 5′ TATGCAAGGCTTACAACCACA 3′ (SEQ ID NO: 115), or a 3′ IgG2a constant region specific primer, 5′ AGGACAGGGCTTGATTGTGGG 3′ (SEQ ID NO: 116). Kappa chain variable regions were amplified with the above 5′ primers and a 3′ kappa constant region specific primer, 5′ CTCATTCCTGTTGAAGCTCTTGACAAT 3′ (SEQ ID NO: 117). Lambda chain variable regions were amplified with the above 5′ primers and a mix of 3′ lambda constant region specific primers, 5′ GCACGGGACAAACTCTTCTC 3′ (SEQ ID NO: 118) and 5′ CACAGTGTCCCCTTCATGTG 3′ (SEQ ID NO: 119). Individual PCR products were isolated by agarose gel electrophoresis and purified using the QIAQUICK® Gel Purification kit according to the kit vendor's instructions (Qiagen). The PCR products were subsequently cloned into the PCR® 4Blunt TOPO® plasmid or PCR2.1® TOPO plasmid using the ZERO BLUNT® TOPO® PCR Cloning Kit or the TOPO® TA Cloning Kit, respectively, according to the kit vendor's instructions (Invitrogen) and transformed into DH5-α bacteria (Invitrogen) through standard molecular biology techniques. Plasmid DNA isolated from transformed bacterial clones was sequenced using M13 Forward (5′ GTAAAACGACGGCCAGT 3′) (SEQ ID NO: 120) and M13 Reverse primers (5′ CAGGAAACAGCTATGACC 3′) (SEQ ID NO: 121) by Beckman Genomics (Danvers, Mass.), using standard dideoxy DNA sequencing methods to identify the sequence of the variable region sequences. The sequences were analyzed using VECTOR NTI® software (Invitrogen) and the IMGT/V-Quest web server (imgt.cines.fr) to identify and confirm variable region sequences. The nucleic acid sequences encoding and the protein sequences defining variable regions of the murine monoclonal antibodies are shown below (amino terminal signal peptide sequences are not shown). CDR sequences (Kabat definition) are indicated by bold font and underlining in the amino acid sequences. Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the07F01 Antibody(SEQ ID NO: 1)1gaggtgaagc ttctcgagtc tggaggtggc ctggtgcagc cgggtggatc cctgaaactc61tcctgtgcag cctcaggatt cgattttagt agacactgga tgagttgggt ccggctggct121ccagggaaag ggctagaatg gatcgcagaa attaatccag atagcagaac gataaactat181acgccatctc taaaggagaa attcatcatc tccagagaca acgccaaaaa ttcgctgttt241ctgcaaatga acagagtgag atctgaggac acagcccttt attactgtgc aagacgggta301agaattcatt actacggcgc tatggactgc tggggtcaag gaacctcagt caccgtctcc361tcaProtein Sequence Defining the Heavy Chain Variable Region of the07F01 Antibody(SEQ ID NO: 2)1evkllesggg lvqpggslkl scaasgfdfs rhwms wvrla pgkglewia e inpdsrtiny61tpslke kfii srdnaknslf lqmnrvrsed talyycar rv rihyygamdc wgqgtsvtvs121sNucleic Acid Sequence Encoding the Kappa Chain Variable Region of the07F01 Antibody(SEQ ID NO: 3)1gacattgtgt tgacccagtc tcaaaaaatc gtgtccacat cagtaggagc cagggtcagc61gtcacctgca aggccagtca gaatgtgggt tctagtttag tctggtatca acagaaacca121ggtcaatctc ctaaaacact gatttactcg gcatccttcc ggtacagtgg agtccctgat181cgcttcacag gcagtggatc tgggacagat ttcactctca ccatcagcaa tgtgcagtct241gaagacttgg cagattattt ctgtcaacaa tataataact atccgctcac gttcggtgct301gggaccaagc tggagctgaa aProtein Sequence Defining the Kappa Chain Variable Region of the07F01 Antibody(SEQ ID NO: 4)1divltqsqki vstsvgarvs vtc kasqnvg sslv wyqqkp gqspktliy s asfry sgvpd61rftgsgsgtd ftltisnvqs edladyfc qq ynnyplt fga gtklelkNucleic Acid Sequence Encoding the Heavy Chain Variable Region of the12B11 Antibody(SEQ ID NO: 11)1gaggtgcagt tagtggagtc tgggggaggc ttagtgaagc ctggagggtc cctgaaactc61tcctgtgcag cctctggatt cactttcagt acctatgcca tgtcttggat tcgccagact121ccggagaaga ggctggagtg ggtcgcagga atcactaatg gtggtagttt cacctactat181ccagacactg tgaagggacg attcaccatc tccagagaca atgccaggaa catcctatac241ctgcaaatga gcggtctgag gtctgaggac acggccatgt attattgtgc aagacagggt301tactatggtg ttaactttga ctactggggc caaggcacca ctctcacagt ctcctcaProtein Sequence Defining the Heavy Chain Variable Region of the12B11 Antibody(SEQ ID NO: 12)1evqlvesggg lvkpggslkl scaasgftfs tyams wirqt pekrlewva g itnggsftyy61pdtvkg rfti srdnarnily lqmsglrsed tamyycar qg yygvnfdy wg qgttltvssNucleic Acid Sequence Encoding the Kappa Chain Variable Region of the12B11 Antibody(SEQ ID NO: 13)1gatgctgtga tgacccaaac tccactctcc ctgcctgtca gtcttggaga tcaagcctcc61atctcttgca ggtctagtca gagccttgaa aacagtaacg gaaacactta tttgaactgg121tacctccaga aaccaggcca gtctccacag ctcctgatct acagggtttc caaccgattt181tctggggtcc cagacaggtt cagtggtagt ggatcaggga cagatttcac actgaaaatc241atcagagtgg aggctgagga tttgggactt tatttctgcc tccaagttac acatgtcccg301cacacgttcg gaggggggac caaactggaa ttaaaaProtein Sequence Defining the Kappa Chain Variable Region of the12B11 Antibody(SEQ ID NO: 14)1davmtqtpls lpvslgdqas isc rssqsle nsngntyln w ylqkpgqspq lliy rvsnrf61s gvpdrfsgs gsgtdftlki irveaedlgl yfc lqvthvp ht fgggtkle lkNucleic Acid Sequence Encoding the Heavy Chain Variable Region of the17F06 Antibody(SEQ ID NO: 21)1gaagtgaagc tggtggagtc ggggggaggc ttagtgaagc ctggagcgtc tctgaaactc61tcctgtgcag cctctggatt cattttcagt tcctatggca tgtcttgggt tcgccagact121tcagacaaga ggctggagtg ggtcgcttcc attagtagtg gtggtggtac cacctactat181ctagacactg taaagggccg attcaccatc tccagagaga atgccaagga caccctgtac241ctgcaaatga gtggtctgaa gtctgaagac acggccttgt attactgtac aagaggccaa301tggttactaa agtttgctta ctggggccaa gggactctgg tcactgtctc tgcaProtein Sequence Defining the Heavy Chain Variable Region of the17F06 Antibody(SEQ ID NO: 22)1evklvesggg lvkpgaslkl scaasgfifs sygms wvrqt sdkrlewva s issgggttyy61ldtvkg rfti srenakdtly lqmsglksed talyyctr gq wllkfay wgq gtlvtvsaNucleic Acid Sequence Encoding the Lambda Chain Variable Region of the17F06 Antibody(SEQ ID NO: 23)1caacttgtgc tcactcagtc atcttcagcc tctttctccc tgggagcctc agcaaaactc61acgtgcacct tgagtagtca gcacactacg tacaccattg aatggtatca gcaactgcca121ctcaagcctc ctaagtatgt gatggagctt aagaaagatg gaagccacag cacaggtgtt181gggattcctg atcgcttctc tggatccagc tctggtgctg atcgctacct taccatttcc241aacatccagc ctgaagatga agcaatatac atctgtggtg tgggtgagac aattgaggac301caatttgtgt atgttttcgg cggtggcacc aaggtcactg tcctaProtein Sequence Defining the Lambda Chain Variable Region of the17F06 Antibody(SEQ ID NO: 24)1qlvltqsssa sfslgasakl tc tlssqhtt ytie wyqqlp lkppkyvme l kkdgshstgv61gipdrfsgss sgadryltis niqpedeaiy ic gvgetied qfvyv fgggt kvtvlNucleic Acid Sequence Encoding the Heavy Chain Variable Region of the18H09 Antibody(SEQ ID NO: 31)1gaggtgcagc ttcaggagtc aggacctagc ctcgtgaaac cttctcagac tctgtccctc61acctgttatg tcactggcga ctccatcacc agtgattact ggaattggat ccggaaattc121ccaggaaata aacttgagta catgggatat atcagctaca gtggtagcac ttactacaat181ccatctctca aaagtcgaat ctccatcact cgagacacat ccaagaacca gttctacctt241cggttgaatt ctgtgactac tgaggacaca gccacatatt actgtgcaag aacccatata301cttacgattg cttactgggg ccaagggact ctggtcactg tctctgcaProtein Sequence Defining the Heavy Chain Variable Region of the18H09 Antibody(SEQ ID NO: 32)1evqlqesgps lvkpsqtlsl tcyvtgdsit sdywn wirkf pgnkleymg y isysgstyyn61pslks risit rdtsknqfyl rlnsvttedt atyycar thi ltiay wgqgt lvtvsaNucleic Acid Sequence Encoding the Lambda Chain Variable Region of the18H09 Antibody(SEQ ID NO: 33)1caggctgttg tgactcagga atctgcactc accacatcac ctggtgaaac agtcacactc61acttgtcgct caagtgccgg ggctgttaca actagtaact ttgccaactg ggtccaagaa121aaaccagatc atttattcac tggtctaata ggtgatacca acatccgagc tccaggtgtt181cctgccagat tctcaggctc cctgattgga gacaaggctg ccctcaccat cacaggggca241cagactgagg atgaggcaat atatttctgt gctctttggt acagcaacca ttactgggtg301ttcggtggag gaaccaaact gactgtcctaProtein Sequence Defining the Lambda Chain Variable Region of the18H09 Antibody(SEQ ID NO: 34)1qavvtqesal ttspgetvtl tc rssagavt tsnfan wvqe kpdhlftgli g dtnirap gv61parfsgslig dkaaltitga qtedeaiyfc alwysnhywv fgggtkltvlNucleic Acid Sequence Encoding the Heavy Chain Variable Region of the29B06 Antibody(SEQ ID NO: 41)1gaggtgcagc ttcaggagtc aggacctagc ctcgtgaaac cttctcagac tctgtccctc61acctgttctg tcactggcga ctccatcacc agtggttact ggaactggat ccggaaattc121ccagggaata aacttgagta catggggtac ataagctaca gtggtaaaac ttactacaat181ccatctctca aaagtcgaat ctccatcact cgagacacat ccaagaacca ttactacctg241cagttgattt ctgtgactgc tgaggacaca gccacatatt actgtgcaag gtctaagtac301gactatgcta tggactactg gggtcaagga acctcagtca ccgtctcctc aProtein Sequence Defining the Heavy Chain Variable Region of the29B06 Antibody(SEQ ID NO: 42)1evqlqesgps lvkpsqtlsl tcsvtgdsit sgywn wirkf pgnkleymg y isysgktyyn61pslks risit rdtsknhyyl qlisvtaedt atyycar sky dyamdy wgqg tsvtvssNucleic Acid Sequence Encoding the Kappa Chain Variable Region of the29B06 Antibody(SEQ ID NO: 43)1gacattgtgc tgacccaatc tccagcttct ttggctgtgt ctctaggaca gagggccacc61atctcctgca gagccagcga aattgttgat aattttggca ttagttttat gaactggttc121caacagaaac caggacagcc acccaaactc ctcatctatg ctgcatccaa ccaaggatcc181ggggtccctg ccaggtttag tggcagtggg tctgggacag acttcagcct caacatccat241cctgtggagg aggatgatac tgcaatgtat ttctgtcagc aaagtaagga ggttcctccg301acgttcggtg gaggcaccaa gctggaaatc aaaProtein Sequence Defining the Kappa Chain Variable Region of the29B06 Antibody(SEQ ID NO: 44)1divltqspas lavslgqrat isc raseivd nfgisfmn wf qqkpgqppkl liy aasnqgs61gvparfsgsg sgtdfslnih pveeddtamy fc qqskevpp t fgggtklei k The amino acid sequences defining the immunoglobulin heavy chain variable regions for the antibodies produced in Example 2 are aligned in FIG. 2 . Amino terminal signal peptide sequences (for expression/secretion) are not shown. CDR 1 , CDR 2 , and CDR 3 (Kabat definition) are identified by boxes. FIG. 3 shows an alignment of the separate CDR 1 , CDR 2 , and CDR 3 sequences for each antibody. The amino acid sequences defining the immunoglobulin light chain variable regions of the antibodies in Example 2 are aligned in FIG. 4 . Amino terminal signal peptide sequences (for expression/secretion) are not shown. CDR 1 , CDR 2 and CDR 3 are identified by boxes. FIG. 5 shows an alignment of the separate CDR 1 , CDR 2 , and CDR 3 sequences for each antibody. Table 1 shows the SEQ ID NO. of each sequence discussed in this Example. TABLE 1SEQ. ID NO.Nucleic Acid or Protein107F01 Heavy Chain Variable Region-nucleic acid207F01 Heavy Chain Variable Region-protein307F01 Light (kappa) Chain Variable Region-nucleicacid407F01 Light (kappa) Chain Variable Region-protein507F01 Heavy Chain CDR 1607F01 Heavy Chain CDR 2707F01 Heavy Chain CDR 3807F01 Light (kappa) Chain CDR 1907F01 Light (kappa) Chain CDR 21007F01 Light (kappa) Chain CDR 31112B11 Heavy Chain Variable Region-nucleic acid1212B11 Heavy Chain Variable Region-protein1312B11 Light (kappa) Chain Variable Region-nucleicacid1412B11 Light (kappa) Chain Variable Region-protein1512B11 Heavy Chain CDR 11612B11 Heavy Chain CDR 21712B11 Heavy Chain CDR 31812B11 Light (kappa) Chain CDR 11912B11 Light (kappa) Chain CDR 22012B11 Light (kappa) Chain CDR 32117F06 Heavy Chain Variable Region-nucleic acid2217F06 Heavy Chain Variable Region-protein2317F06 Light (lambda) Chain Variable Region-nucleicacid2417F06 Light (lambda) Chain Variable Region-protein2517F06 Heavy Chain CDR 12617F06 Heavy Chain CDR 22717F06 Heavy Chain CDR 32817F06 Light (lambda) Chain CDR 12917F06 Light (lambda) Chain CDR 23017F06 Light (lambda) Chain CDR 33118H09 Heavy Chain Variable Region-nucleic acid3218H09 Heavy Chain Variable Region-protein3318H09 Light (lambda) Chain Variable Region-nucleicacid3418H09 Light (lambda) Chain Variable Region-protein3518H09 Heavy Chain CDR 13618H09 Heavy Chain CDR 23718H09 Heavy Chain CDR 33818H09 Light (lambda) Chain CDR 13918H09 Light (lambda) Chain CDR 24018H09 Light (lambda) Chain CDR 34129B06 Heavy Chain Variable Region-nucleic acid4229B06 Heavy Chain Variable Region-protein4329B06 Light (kappa) Chain Variable Region-nucleicacid4429B06 Light (kappa) Chain Variable Region-protein4529B06 Heavy Chain CDR 14629B06 Heavy Chain CDR 24729B06 Heavy Chain CDR 34829B06 Light (kappa) Chain CDR 14929B06 Light (kappa) Chain CDR 25029B06 Light (kappa) Chain CDR 3 Mouse monoclonal antibody heavy chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 2. TABLE 2CDR1CDR2CDR3Kabat07F01RHWMSEINPDSRTINYTPSLKERVRIHYYGAMDC(SEQ ID(SEQ ID NO: 6)(SEQ ID NO: 7)NO: 5)12B11TYAMSGITNGGSFTYYPDTVKGQGYYGVNFDY(SEQ ID(SEQ ID NO: 16)(SEQ ID NO: 17)NO: 15)17F06SYGMSSISSGGGTTYYLDTVKGGQWLLKFAY(SEQ ID(SEQ ID NO: 26)(SEQ ID NO: 27)NO: 25)18H09SDYWNYISYSGSTYYNPSLKTHILTIAY(SEQ ID(SEQ ID NO: 36)(SEQ ID NO: 37)NO: 35)29B06SGYWNYISYSGKTYYNPSLKSSKYDYAMDY(SEQ ID(SEQ ID NO: 46)(SEQ ID NO: 47)NO: 45)Chothia07F01GFDFSRHNPDSRTRVRIHYYGAMDC(SEQ ID(SEQ ID NO: 52)(SEQ ID NO: 7)NO: 51)12B11GFTFSTYTNGGSFQGYYGVNFDY(SEQ ID(SEQ ID NO: 54)(SEQ ID NO: 17)NO: 53)17F06GFIFSSYSSGGGTGQWLLKFAY(SEQ ID(SEQ ID NO: 56)(SEQ ID NO: 27)NO: 55)18H09GDSITSDSYSGSTHILTIAY(SEQ ID(SEQ ID NO: 58)(SEQ ID NO: 37)NO: 57)29B06GDSITSGSYSGKSKYDYAMDY(SEQ ID(SEQ ID NO: 60)(SEQ ID NO: 47)NO: 59)IMGT07F01GFDFSRHWINPDSRTIARRVRIHYYGAMDC(SEQ ID(SEQ ID NO: 62)(SEQ ID NO: 63)NO: 61)12B11GFTFSTYAITNGGSFTARQGYYGVNFDY(SEQ ID(SEQ ID NO: 65)(SEQ ID NO: 66)NO: 64)17F06GFIFSSYGISSGGGTTTRGQWLLKFAY(SEQ ID(SEQ ID NO: 68)(SEQ ID NO: 69)NO: 67)18H09GDSITSDYISYSGSTARTHILTIAY(SEQ ID(SEQ ID NO: 71)(SEQ ID NO: 72)NO: 70)29B06GDSITSGYISYSGKTARSKYDYAMDY(SEQ ID(SEQ ID NO: 74)(SEQ ID NO: 75)NO: 73) Mouse monoclonal antibody Kappa light chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 3. TABLE 3CDR1CDR2CDR3Kabat/Chothia07F01KASQNVGSSLVSASFRYSQQYNNYPLT(SEQ ID NO: 8)(SEQ ID(SEQ ID NO: 10)NO: 9)12B11RSSQSLENSNGNTYLNRVSNRFSLQVTHVPHT(SEQ ID NO: 18)(SEQ ID(SEQ ID NO: 20)NO: 19)17F06TLSSQHTTYTIELKKDGSHSTGVGVGETIEDQFVYV(SEQ ID NO: 28)(SEQ ID(SEQ ID NO: 30)NO: 29)18H09RSSAGAVTTSNFANDTNIRAPALWYSNHYWV(SEQ ID NO: 38)(SEQ ID(SEQ ID NO: 40)NO: 39)29B06RASEIVDNFGISFMNAASNQGSQQSKEVPPT(SEQ ID NO: 48)(SEQ ID(SEQ ID NO: 50)NO: 49)IMGT07F01QNVGSSSASQQYNNYPLT(SEQ ID NO: 76)(SEQ ID NO: 10)12B11QSLENSNGNTYRVSLQVTHVPHT(SEQ ID NO: 77)(SEQ ID NO: 20)17F06SQHTTYTLKKDGSHGVGETIEDQFVYV(SEQ ID NO: 78)(SEQ ID(SEQ ID NO: 30)NO: 79)18H09AGAVTTSNFDTNALWYSNHYWV(SEQ ID NO: 80)(SEQ ID NO: 40)29B06EIVDNFGISFAASQQSKEVPPT(SEQ ID NO: 81)(SEQ ID NO: 50) To create the complete heavy or kappa chain antibody sequences, each variable sequence above is combined with its respective constant region. For example, a complete heavy chain comprises a heavy variable sequence followed by the murine IgG1 or IgG2a heavy chain constant sequence, a complete kappa chain comprises a kappa variable sequence followed by the murine kappa light chain constant sequence, and a complete lambda chain comprises a lambda variable sequence followed by the murine lambda IGLC1 or IGLC2 light chain constant sequence. Nucleic Acid Sequence Encoding the Murine IgG1 Heavy Chain Constant Region(SEQ ID NO: 82)1gccaaaacga cacccccatc tgtctatcca ctggcccctg gatctgctgc ccaaactaac61tccatggtga ccctgggatg cctggtcaag ggctatttcc ctgagccagt gacagtgacc121tggaactctg gatccctgtc cagcggtgtg cacaccttcc cagctgtcct gcagtctgac181ctctacactc tgagcagctc agtgactgtc ccctccagca cctggcccag cgagaccgtc241acctgcaacg ttgcccaccc ggccagcagc accaaggtgg acaagaaaat tgtgcccagg301gattgtggtt gtaagccttg catatgtaca gtcccagaag tatcatctgt cttcatcttc361cccccaaagc ccaaggatgt gctcaccatt actctgactc ctaaggtcac gtgtgttgtg421gtagacatca gcaaggatga tcccgaggtc cagttcagct ggtttgtaga tgatgtggag481gtgcacacag ctcagacgca accccgggag gagcagttca acagcacttt ccgctcagtc541agtgaacttc ccatcatgca ccaggactgg ctcaatggca aggagttcaa atgcagggtc601aacagtgcag ctttccctgc ccccatcgag aaaaccatct ccaaaaccaa aggcagaccg661aaggctccac aggtgtacac cattccacct cccaaggagc agatggccaa ggataaagtc721agtctgacct gcatgataac agacttcttc cctgaagaca ttactgtgga gtggcagtgg781aatgggcagc cagcggagaa ctacaagaac actcagccca tcatggacac agatggctct841tacttcgtct acagcaagct caatgtgcag aagagcaact gggaggcagg aaatactttc901acctgctctg tgttacatga gggcctgcac aaccaccata ctgagaagag cctctcccac961tctcctggta aaProtein Sequence Defining the Murine IgG1 Heavy Chain Constant Region(SEQ ID NO: 83)1akttppsvyp lapgsaaqtn smvtlgclvk gyfpepvtvt wnsgslssgv htfpavlqsd61lytlsssvtv psstwpsetv tcnvahpass tkvdkkivpr dcgckpcict vpevssvfif121ppkpkdvlti tltpkvtcvv vdiskddpev qfswfvddve vhtaqtqpre eqfnstfrsv181selpimhqdw lngkefkcrv nsaafpapie ktisktkgrp kapqvytipp pkeqmakdkv241sltcmitdff peditvewqw ngqpaenykn tqpimdtdgs yfvysklnvq ksnweagntf301tcsvlheglh nhhtekslsh spgkNucleic Acid Sequence Encoding the Murine IgG2a Heavy Chain Constant Region(SEQ ID NO: 84)1gccaaaacaa cagccccatc ggtctatcca ctggcccctg tgtgtggaga tacaactggc61tcctcggtga ctctaggatg cctggtcaag ggttatttcc ctgagccagt gaccttgacc121tggaactctg gatccctgtc cagtggtgtg cacaccttcc cagctgtcct gcagtctgac181ctctacaccc tcagcagctc agtgactgta acctcgagca cctggcccag ccagtccatc241acctgcaatg tggcccaccc ggcaagcagc accaaggtgg acaagaaaat tgagcccaga301gggcccacaa tcaagccctg tcctccatgc aaatgcccag cacctaacct cttgggtgga361ccatccgtct tcatcttccc tccaaagatc aaggatgtac tcatgatctc cctgagcccc421atagtcacat gtgtggtggt ggatgtgagc gaggatgacc cagatgtcca gatcagctgg481tttgtgaaca acgtggaagt acacacagct cagacacaaa cccatagaga ggattacaac541agtactctcc gggtggtcag tgccctcccc atccagcacc aggactggat gagtggcaag601gagttcaaat gcaaggtcaa caacaaagac ctcccagcgc ccatcgagag aaccatctca661aaacccaaag ggtcagtaag agctccacag gtatatgtct tgcctccacc agaagaagag721atgactaaga aacaggtcac tctgacctgc atggtcacag acttcatgcc tgaagacatt781tacgtggagt ggaccaacaa cgggaaaaca gagctaaact acaagaacac tgaaccagtc841ctggactctg atggttctta cttcatgtac agcaagctga gagtggaaaa gaagaactgg901gtggaaagaa atagctactc ctgttcagtg gtccacgagg gtctgcacaa tcaccacacg961actaagagct tctcccggac tccgggtaaaProtein Sequence Defining the Murine IgG2a Heavy Chain Constant Region(SEQ ID NO: 85)1akttapsvyp lapvcgdttg ssvtlgclvk gyfpepvtlt wnsgslssgv htfpavlqsd61lytlsssvtv tsstwpsqsi tcnvahpass tkvdkkiepr gptikpcppc kcpapnllgg121psvfifppki kdvlmislsp ivtcvvvdvs eddpdvqisw fvnnvevhta qtqthredyn181stlrvvsalp iqhqdwmsgk efkckvnnkd lpapiertis kpkgsvrapq vyvlpppeee241mtkkqvtltc mvtdfmpedi yvewtnngkt elnykntepv ldsdgsyfmy sklrvekknw301vernsyscsv vheglhnhht tksfsrtpgkNucleic Acid Sequence Encoding the Murine Kappa Light Chain Constant Region(SEQ ID NO: 86)1cgggctgatg ctgcaccaac tgtatccatc ttcccaccat ccagtgagca gttaacatct61ggaggtgcct cagtcgtgtg cttcttgaac aacttctacc ccaaagacat caatgtcaag121tggaagattg atggcagtga acgacaaaat ggcgtcctga acagttggac tgatcaggac181agcaaagaca gcacctacag catgagcagc accctcacgt tgaccaagga cgagtatgaa241cgacataaca gctatacctg tgaggccact cacaagacat caacttcacc cattgtcaag301agcttcaaca ggaatgagtg tProtein Sequence Defining the Murine Kappa Light Chain Constant Region(SEQ ID NO: 87)1radaaptvsi fppsseqlts ggasvvcfln nfypkdinvk wkidgserqn gvlnswtdqd61skdstysmss tltltkdeye rhnsytceat hktstspivk sfnrnecNucleic Acid Sequence Encoding the Murine Lambda (IGLC1) Light Chain ConstantRegion(SEQ ID NO: 88)1ggccagccca agtcttcgcc atcagtcacc ctgtttccac cttcctctga agagctcgag61actaacaagg ccacactggt gtgtacgatc actgatttct acccaggtgt ggtgacagtg121gactggaagg tagatggtac ccctgtcact cagggtatgg agacaaccca gccttccaaa181cagagcaaca acaagtacat ggctagcagc tacctgaccc tgacagcaag agcatgggaa241aggcatagca gttacagctg ccaggtcact catgaaggtc acactgtgga gaagagtttg301tcccgtgctg actgttccProtein Sequence Defining the Murine Lambda (IGLC1) Light Chain ConstantRegion(SEQ ID NO: 89)1gqpksspsvt lfppsseele tnkatlvcti tdfypgvvtv dwkvdgtpvt qgmettqpsk61qsnnkymass yltltarawe rhssyscqvt heghtveksl sradcsNucleic Acid Sequence Encoding the Murine Lambda (IGLC2) Light Chain ConstantRegion(SEQ ID NO: 90)1ggtcagccca agtccactcc cactctcacc gtgtttccac cttcctctga ggagctcaag61gaaaacaaag ccacactggt gtgtctgatt tccaactttt ccccgagtgg tgtgacagtg121gcctggaagg caaatggtac acctatcacc cagggtgtgg acacttcaaa tcccaccaaa181gagggcaaca agttcatggc cagcagcttc ctacatttga catcggacca gtggagatct241cacaacagtt ttacctgtca agttacacat gaaggggaca ctgtggagaa gagtctgtct301cctgcagaat gtctcProtein Sequence Defining the Murine Lambda (IGLC2) Light Chain ConstantRegion(SEQ ID NO: 91)1gqpkstptlt vfppsseelk enkatlvcli snfspsgvtv awkangtpit qgvdtsnptk61egnkfmassf lhltsdqwrs hnsftcqvth egdtveksls paecl The following sequences represent the actual or contemplated full length heavy and light chain sequence (i.e., containing both the variable and constant regions sequences) for each antibody described in this Example. Signal sequences for proper secretion of the antibodies (e.g., signal sequences at the 5′ end of the DNA sequences or the amino terminal end of the protein sequences) are not shown in the full length heavy and light chain sequences disclosed herein and are not included in the final secreted protein. Also not shown are stop codons for termination of translation required at the 3′ end of the DNA sequences. It is within ordinary skill in the art to select a signal sequence and/or a stop codon for expression of the disclosed full length IgG heavy chain and light chain sequences. It is also contemplated that the variable region sequences can be ligated to other constant region sequences to produce active full length IgG heavy and light chains. Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (HeavyChain Variable Region and IgG1 Constant Region) of 07F01(SEQ ID NO: 92)1gaggtgaagc ttctcgagtc tggaggtggc ctggtgcagc cgggtggatc cctgaaactc61tcctgtgcag cctcaggatt cgattttagt agacactgga tgagttgggt ccggctggct121ccagggaaag ggctagaatg gatcgcagaa attaatccag atagcagaac gataaactat181acgccatctc taaaggagaa attcatcatc tccagagaca acgccaaaaa ttcgctgttt241ctgcaaatga acagagtgag atctgaggac acagcccttt attactgtgc aagacgggta301agaattcatt actacggcgc tatggactgc tggggtcaag gaacctcagt caccgtctcc361tcagccaaaa cgacaccccc atctgtctat ccactggccc ctggatctgc tgcccaaact421aactccatgg tgaccctggg atgcctggtc aagggctatt tccctgagcc agtgacagtg481acctggaact ctggatccct gtccagcggt gtgcacacct tcccagctgt cctgcagtct541gacctctaca ctctgagcag ctcagtgact gtcccctcca gcacctggcc cagcgagacc601gtcacctgca acgttgccca cccggccagc agcaccaagg tggacaagaa aattgtgccc661agggattgtg gttgtaagcc ttgcatatgt acagtcccag aagtatcatc tgtcttcatc721ttccccccaa agcccaagga tgtgctcacc attactctga ctcctaaggt cacgtgtgtt781gtggtagaca tcagcaagga tgatcccgag gtccagttca gctggtttgt agatgatgtg841gaggtgcaca cagctcagac gcaaccccgg gaggagcagt tcaacagcac tttccgctca901gtcagtgaac ttcccatcat gcaccaggac tggctcaatg gcaaggagtt caaatgcagg961gtcaacagtg cagctttccc tgcccccatc gagaaaacca tctccaaaac caaaggcaga1021ccgaaggctc cacaggtgta caccattcca cctcccaagg agcagatggc caaggataaa1081gtcagtctga cctgcatgat aacagacttc ttccctgaag acattactgt ggagtggcag1141tggaatgggc agccagcgga gaactacaag aacactcagc ccatcatgga cacagatggc1201tcttacttcg tctacagcaa gctcaatgtg cagaagagca actgggaggc aggaaatact1261ttcacctgct ctgtgttaca tgagggcctg cacaaccacc atactgagaa gagcctctcc1321cactctcctg gtaaaProtein Sequence Defining the Full Length Heavy Chain Sequence (Heavy ChainVariable Region and IgG1 Constant Region) of 07F01(SEQ ID NO: 93)1evkllesggg lvqpggslkl scaasgfdfs rhwmswvrla pgkglewiae inpdsrtiny61tpslkekfii srdnaknslf lqmnrvrsed talyycarrv rihyygamdc wgqgtsvtvs121sakttppsvy plapgsaaqt nsmvtlgclv kgyfpepvtv twnsgslssg vhtfpavlqs181dlytlsssvt vpsstwpset vtcnvahpas stkvdkkivp rdcgckpcic tvpevssvfi241fppkpkdvlt itltpkvtcv vvdiskddpe vqfswfvddv evhtaqtqpr eeqfnstfrs301vselpimhqd wlngkefkcr vnsaafpapi ektisktkgr pkapqvytip ppkeqmakdk361vsltcmitdf fpeditvewq wngqpaenyk ntqpimdtdg syfvysklnv qksnweagnt421ftcsvlhegl hnhhteksls hspgkNucleic Acid Sequence Encoding the Full Length Light Chain Sequence (KappaChain Variable Region and Constant Region) of 07F01(SEQ ID NO: 94)1gacattgtgt tgacccagtc tcaaaaaatc gtgtccacat cagtaggagc cagggtcagc61gtcacctgca aggccagtca gaatgtgggt tctagtttag tctggtatca acagaaacca121ggtcaatctc ctaaaacact gatttactcg gcatccttcc ggtacagtgg agtccctgat181cgcttcacag gcagtggatc tgggacagat ttcactctca ccatcagcaa tgtgcagtct241gaagacttgg cagattattt ctgtcaacaa tataataact atccgctcac gttcggtgct301gggaccaagc tggagctgaa acgggctgat gctgcaccaa ctgtatccat cttcccacca361tccagtgagc agttaacatc tggaggtgcc tcagtcgtgt gcttcttgaa caacttctac421cccaaagaca tcaatgtcaa gtggaagatt gatggcagtg aacgacaaaa tggcgtcctg481aacagttgga ctgatcagga cagcaaagac agcacctaca gcatgagcag caccctcacg541ttgaccaagg acgagtatga acgacataac agctatacct gtgaggccac tcacaagaca601tcaacttcac ccattgtcaa gagcttcaac aggaatgagt gtProtein Sequence Defining the Full Length Light Chain Sequence (Kappa ChainVariable Region and Constant Region) of 07F01(SEQ ID NO: 95)1divltqsqki vstsvgarvs vtckasqnvg sslvwyqqkp gqspktliys asfrysgvpd61rftgsgsgtd ftltisnvqs edladyfcqq ynnypltfga gtklelkrad aaptvsifpp121sseqltsgga svvcflnnfy pkdinvkwki dgserqngvl nswtdqdskd stysmsstlt181ltkdeyerhn sytceathkt stspivksfn rnecNucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (HeavyChain Variable Region and IgG1 Constant Region) of 12B11(SEQ ID NO: 96)1gaggtgcagt tagtggagtc tgggggaggc ttagtgaagc ctggagggtc cctgaaactc61tcctgtgcag cctctggatt cactttcagt acctatgcca tgtcttggat tcgccagact121ccggagaaga ggctggagtg ggtcgcagga atcactaatg gtggtagttt cacctactat181ccagacactg tgaagggacg attcaccatc tccagagaca atgccaggaa catcctatac241ctgcaaatga gcggtctgag gtctgaggac acggccatgt attattgtgc aagacagggt301tactatggtg ttaactttga ctactggggc caaggcacca ctctcacagt ctcctcagcc361aaaacgacac ccccatctgt ctatccactg gcccctggat ctgctgccca aactaactcc421atggtgaccc tgggatgcct ggtcaagggc tatttccctg agccagtgac agtgacctgg481aactctggat ccctgtccag cggtgtgcac accttcccag ctgtcctgca gtctgacctc541tacactctga gcagctcagt gactgtcccc tccagcacct ggcccagcga gaccgtcacc601tgcaacgttg cccacccggc cagcagcacc aaggtggaca agaaaattgt gcccagggat661tgtggttgta agccttgcat atgtacagtc ccagaagtat catctgtctt catcttcccc721ccaaagccca aggatgtgct caccattact ctgactccta aggtcacgtg tgttgtggta781gacatcagca aggatgatcc cgaggtccag ttcagctggt ttgtagatga tgtggaggtg841cacacagctc agacgcaacc ccgggaggag cagttcaaca gcactttccg ctcagtcagt901gaacttccca tcatgcacca ggactggctc aatggcaagg agttcaaatg cagggtcaac961agtgcagctt tccctgcccc catcgagaaa accatctcca aaaccaaagg cagaccgaag1021gctccacagg tgtacaccat tccacctccc aaggagcaga tggccaagga taaagtcagt1081ctgacctgca tgataacaga cttcttccct gaagacatta ctgtggagtg gcagtggaat1141gggcagccag cggagaacta caagaacact cagcccatca tggacacaga tggctcttac1201ttcgtctaca gcaagctcaa tgtgcagaag agcaactggg aggcaggaaa tactttcacc1261tgctctgtgt tacatgaggg cctgcacaac caccatactg agaagagcct ctcccactct1321cctggtaaaProtein Sequence Defining the Full Length Heavy Chain Sequence (Heavy ChainVariable Region and IgG1 Constant Region) of 12B11(SEQ ID NO: 97)1evqlvesggg lvkpggslkl scaasgftfs tyamswirqt pekrlewvag itnggsftyy61pdtvkgrfti srdnarnily lqmsglrsed tamyycarqg yygvnfdywg qgttltvssa121kttppsvypl apgsaaqtns mvtlgclvkg yfpepvtvtw nsgslssgvh tfpavlqsdl181ytlsssvtvp sstwpsetvt cnvahpasst kvdkkivprd cgckpcictv pevssvfifp241pkpkdvltit ltpkvtcvvv diskddpevq fswfvddvev htaqtqpree qfnstfrsvs301elpimhqdwl ngkefkcrvn saafpapiek tisktkgrpk apqvytippp keqmakdkvs361ltcmitdffp editvewqwn gqpaenyknt qpimdtdgsy fvysklnvqk snweagntft421csvlheglhn hhtekslshs pgkNucleic Acid Sequence Encoding the Full Length Light Chain Sequence (KappaChain Variable Region and Constant Region) of 12B11(SEQ ID NO: 98)1gatgctgtga tgacccaaac tccactctcc ctgcctgtca gtcttggaga tcaagcctcc61atctcttgca ggtctagtca gagccttgaa aacagtaacg gaaacactta tttgaactgg121tacctccaga aaccaggcca gtctccacag ctcctgatct acagggtttc caaccgattt181tctggggtcc cagacaggtt cagtggtagt ggatcaggga cagatttcac actgaaaatc241atcagagtgg aggctgagga tttgggactt tatttctgcc tccaagttac acatgtcccg301cacacgttcg gaggggggac caaactggaa ttaaaacggg ctgatgctgc accaactgta361tccatcttcc caccatccag tgagcagtta acatctggag gtgcctcagt cgtgtgcttc421ttgaacaact tctaccccaa agacatcaat gtcaagtgga agattgatgg cagtgaacga481caaaatggcg tcctgaacag ttggactgat caggacagca aagacagcac ctacagcatg541agcagcaccc tcacgttgac caaggacgag tatgaacgac ataacagcta tacctgtgag601gccactcaca agacatcaac ttcacccatt gtcaagagct tcaacaggaa tgagtgtProtein Sequence Defining the Full Length Light Chain Sequence (Kappa ChainVariable Region and Constant Region) of 12B11(SEQ ID NO: 99)1davmtqtpls lpvslgdqas iscrssqsle nsngntylnw ylqkpgqspq lliyrvsnrf61sgvpdrfsgs gsgtdftlki irveaedlgl yfclqvthvp htfgggtkle lkradaaptv121sifppsseql tsggasvvcf lnnfypkdin vkwkidgser qngvinswtd qdskdstysm181sstltltkde yerhnsytce athktstspi vksfnrnecNucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (HeavyChain Variable Region and IgG2A Constant Region) of 17F06(SEQ ID NO: 100)1gaagtgaagc tggtggagtc ggggggaggc ttagtgaagc ctggagcgtc tctgaaactc61tcctgtgcag cctctggatt cattttcagt tcctatggca tgtcttgggt tcgccagact121tcagacaaga ggctggagtg ggtcgcttcc attagtagtg gtggtggtac cacctactat181ctagacactg taaagggccg attcaccatc tccagagaga atgccaagga caccctgtac241ctgcaaatga gtggtctgaa gtctgaagac acggccttgt attactgtac aagaggccaa301tggttactaa agtttgctta ctggggccaa gggactctgg tcactgtctc tgcagccaaa361acaacagccc catcggtcta tccactggcc cctgtgtgtg gagatacaac tggctcctcg421gtgactctag gatgcctggt caagggttat ttccctgagc cagtgacctt gacctggaac481tctggatccc tgtccagtgg tgtgcacacc ttcccagctg tcctgcagtc tgacctctac541accctcagca gctcagtgac tgtaacctcg agcacctggc ccagccagtc catcacctgc601aatgtggccc acccggcaag cagcaccaag gtggacaaga aaattgagcc cagagggccc661acaatcaagc cctgtcctcc atgcaaatgc ccagcaccta acctcttggg tggaccatcc721gtcttcatct tccctccaaa gatcaaggat gtactcatga tctccctgag ccccatagtc781acatgtgtgg tggtggatgt gagcgaggat gacccagatg tccagatcag ctggtttgtg841aacaacgtgg aagtacacac agctcagaca caaacccata gagaggatta caacagtact901ctccgggtgg tcagtgccct ccccatccag caccaggact ggatgagtgg caaggagttc961aaatgcaagg tcaacaacaa agacctccca gcgcccatcg agagaaccat ctcaaaaccc1021aaagggtcag taagagctcc acaggtatat gtcttgcctc caccagaaga agagatgact1081aagaaacagg tcactctgac ctgcatggtc acagacttca tgcctgaaga catttacgtg1141gagtggacca acaacgggaa aacagagcta aactacaaga acactgaacc agtcctggac1201tctgatggtt cttacttcat gtacagcaag ctgagagtgg aaaagaagaa ctgggtggaa1261agaaatagct actcctgttc agtggtccac gagggtctgc acaatcacca cacgactaag1321agcttctccc ggactccggg taaaProtein Sequence Defining the Full Length Heavy Chain Sequence (Heavy ChainVariable Region and IgG2A Constant Region) of 17F06(SEQ ID NO: 101)1evklvesggg lvkpgaslkl scaasgfifs sygmswvrqt sdkrlewvas issgggttyy61ldtvkgrfti srenakdtly lqmsglksed talyyctrgq wllkfaywgq gtlvtvsaak121ttapsvypla pvcgdttgss vtlgclvkgy fpepvtltwn sgslssgvht fpavlqsdly181tlsssvtvts stwpsqsitc nvahpasstk vdkkieprgp tikpcppckc papnllggps241vfifppkikd vlmislspiv tcvvvdvsed dpdvqiswfv nnvevhtaqt qthredynst301lrvvsalpiq hqdwmsgkef kckvnnkdlp apiertiskp kgsvrapqvy vlpppeeemt361kkqvtltcmv tdfmpediyv ewtnngktel nykntepvld sdgsyfmysk lrvekknwve421rnsyscsvvh eglhnhhttk sfsrtpgkNucleic Acid Sequence Encoding the Full Length Light Chain Sequence (LambdaChain Variable Region and Constant Region (IGLC2)) of 17F06(SEQ ID NO: 102)1caacttgtgc tcactcagtc atcttcagcc tctttctccc tgggagcctc agcaaaactc61acgtgcacct tgagtagtca gcacactacg tacaccattg aatggtatca gcaactgcca121ctcaagcctc ctaagtatgt gatggagctt aagaaagatg gaagccacag cacaggtgtt181gggattcctg atcgcttctc tggatccagc tctggtgctg atcgctacct taccatttcc241aacatccagc ctgaagatga agcaatatac atctgtggtg tgggtgagac aattgaggac301caatttgtgt atgttttcgg cggtggcacc aaggtcactg tcctaggtca gcccaagtcc361actcccactc tcaccgtgtt tccaccttcc tctgaggagc tcaaggaaaa caaagccaca421ctggtgtgtc tgatttccaa cttttccccg agtggtgtga cagtggcctg gaaggcaaat481ggtacaccta tcacccaggg tgtggacact tcaaatccca ccaaagaggg caacaagttc541atggccagca gcttcctaca tttgacatcg gaccagtgga gatctcacaa cagttttacc601tgtcaagtta cacatgaagg ggacactgtg gagaagagtc tgtctcctgc agaatgtctcProtein Sequence Defining the Full Length Light Chain Sequence (Lambda ChainVariable Region and Constant Region (IGLC2)) of 17F06(SEQ ID NO: 103)1qlvltqsssa sfslgasakl tctlssqhtt ytiewyqqlp lkppkyvmel kkdgshstgv61gipdrfsgss sgadryltis niqpedeaiy icgvgetied qfvyvfgggt kvtvlgqpks121tptltvfpps seelkenkat lvclisnfsp sgvtvawkan gtpitqgvdt snptkegnkf181massflhlts dqwrshnsft cqvthegdtv ekslspaeclNucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (HeavyChain Variable Region and IgG1 Constant Region) of 18H09(SEQ ID NO: 104)1gaggtgcagc ttcaggagtc aggacctagc ctcgtgaaac cttctcagac tctgtccctc61acctgttatg tcactggcga ctccatcacc agtgattact ggaattggat ccggaaattc121ccaggaaata aacttgagta catgggatat atcagctaca gtggtagcac ttactacaat181ccatctctca aaagtcgaat ctccatcact cgagacacat ccaagaacca gttctacctt241cggttgaatt ctgtgactac tgaggacaca gccacatatt actgtgcaag aacccatata301cttacgattg cttactgggg ccaagggact ctggtcactg tctctgcagc caaaacgaca361cccccatctg tctatccact ggcccctgga tctgctgccc aaactaactc catggtgacc421ctgggatgcc tggtcaaggg ctatttccct gagccagtga cagtgacctg gaactctgga481tccctgtcca gcggtgtgca caccttccca gctgtcctgc agtctgacct ctacactctg541agcagctcag tgactgtccc ctccagcacc tggcccagcg agaccgtcac ctgcaacgtt601gcccacccgg ccagcagcac caaggtggac aagaaaattg tgcccaggga ttgtggttgt661aagccttgca tatgtacagt cccagaagta tcatctgtct tcatcttccc cccaaagccc721aaggatgtgc tcaccattac tctgactcct aaggtcacgt gtgttgtggt agacatcagc781aaggatgatc ccgaggtcca gttcagctgg tttgtagatg atgtggaggt gcacacagct841cagacgcaac cccgggagga gcagttcaac agcactttcc gctcagtcag tgaacttccc901atcatgcacc aggactggct caatggcaag gagttcaaat gcagggtcaa cagtgcagct961ttccctgccc ccatcgagaa aaccatctcc aaaaccaaag gcagaccgaa ggctccacag1021gtgtacacca ttccacctcc caaggagcag atggccaagg ataaagtcag tctgacctgc1081atgataacag acttcttccc tgaagacatt actgtggagt ggcagtggaa tgggcagcca1141gcggagaact acaagaacac tcagcccatc atggacacag atggctctta cttcgtctac1201agcaagctca atgtgcagaa gagcaactgg gaggcaggaa atactttcac ctgctctgtg1261ttacatgagg gcctgcacaa ccaccatact gagaagagcc tctcccactc tcctggtaaaProtein Sequence Defining the Full Length Heavy Chain Sequence (Heavy ChainVariable Region and IgG1 Constant Region) of 18H09(SEQ ID NO: 105)1evqlqesgps lvkpsqtlsl tcyvtgdsit sdywnwirkf pgnkleymgy isysgstyyn61pslksrisit rdtsknqfyl rinsvttedt atyycarthi ltiaywgqgt lvtvsaaktt121ppsvyplapg saaqtnsmvt lgclvkgyfp epvtvtwnsg slssgvhtfp avlqsdlytl181sssvtvpsst wpsetvtcnv ahpasstkvd kkivprdcgc kpcictvpev ssvfifppkp241kdvltitltp kvtcvvvdis kddpevqfsw fvddvevhta qtqpreeqfn stfrsyselp301imhqdwlngk efkcrvnsaa fpapiektis ktkgrpkapq vytipppkeq makdkvsltc361mitdffpedi tvewqwngqp aenykntqpi mdtdgsyfvy sklnvqksnw eagntftcsv421lheglhnhht ekslshspgkNucleic Acid Sequence Encoding the Full Length Light Chain Sequence (LambdaChain Variable Region and Constant Region (IGLC1)) of 18H09(SEQ ID NO: 106)1caggctgttg tgactcagga atctgcactc accacatcac ctggtgaaac agtcacactc61acttgtcgct caagtgccgg ggctgttaca actagtaact ttgccaactg ggtccaagaa121aaaccagatc atttattcac tggtctaata ggtgatacca acatccgagc tccaggtgtt181cctgccagat tctcaggctc cctgattgga gacaaggctg ccctcaccat cacaggggca241cagactgagg atgaggcaat atatttctgt gctctttggt acagcaacca ttactgggtg301ttcggtggag gaaccaaact gactgtccta ggccagccca agtcttcgcc atcagtcacc361ctgtttccac cttcctctga agagctcgag actaacaagg ccacactggt gtgtacgatc421actgatttct acccaggtgt ggtgacagtg gactggaagg tagatggtac ccctgtcact481cagggtatgg agacaaccca gccttccaaa cagagcaaca acaagtacat ggctagcagc541tacctgaccc tgacagcaag agcatgggaa aggcatagca gttacagctg ccaggtcact601catgaaggtc acactgtgga gaagagtttg tcccgtgctg actgttccProtein Sequence Defining the Full Length Light Chain Sequence (Lambda ChainVariable Region and Constant Region (IGLC1)) of 18H09(SEQ ID NO: 107)1qavvtqesal ttspgetvtl tcrssagavt tsnfanwvqe kpdhlftgli gdtnirapgv61parfsgslig dkaaltitga qtedeaiyfc alwysnhywv fgggtkltvl gqpksspsvt121lfppsseele tnkatlvcti tdfypgvvtv dwkvdgtpvt qgmettqpsk qsnnkymass181yltltarawe rhssyscqvt heghtveksl sradcsNucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (HeavyChain Variable Region and IgG1 Constant Region) of 29B06(SEQ ID NO: 108)1gaggtgcagc ttcaggagtc aggacctagc ctcgtgaaac cttctcagac tctgtccctc61acctgttctg tcactggcga ctccatcacc agtggttact ggaactggat ccggaaattc121ccagggaata aacttgagta catggggtac ataagctaca gtggtaaaac ttactacaat181ccatctctca aaagtcgaat ctccatcact cgagacacat ccaagaacca ttactacctg241cagttgattt ctgtgactgc tgaggacaca gccacatatt actgtgcaag gtctaagtac301gactatgcta tggactactg gggtcaagga acctcagtca ccgtctcctc agccaaaacg361acacccccat ctgtctatcc actggcccct ggatctgctg cccaaactaa ctccatggtg421accctgggat gcctggtcaa gggctatttc cctgagccag tgacagtgac ctggaactct481ggatccctgt ccagcggtgt gcacaccttc ccagctgtcc tgcagtctga cctctacact541ctgagcagct cagtgactgt cccctccagc acctggccca gcgagaccgt cacctgcaac601gttgcccacc cggccagcag caccaaggtg gacaagaaaa ttgtgcccag ggattgtggt661tgtaagcctt gcatatgtac agtcccagaa gtatcatctg tcttcatctt ccccccaaag721cccaaggatg tgctcaccat tactctgact cctaaggtca cgtgtgttgt ggtagacatc781agcaaggatg atcccgaggt ccagttcagc tggtttgtag atgatgtgga ggtgcacaca841gctcagacgc aaccccggga ggagcagttc aacagcactt tccgctcagt cagtgaactt901cccatcatgc accaggactg gctcaatggc aaggagttca aatgcagggt caacagtgca961gctttccctg cccccatcga gaaaaccatc tccaaaacca aaggcagacc gaaggctcca1021caggtgtaca ccattccacc tcccaaggag cagatggcca aggataaagt cagtctgacc1081tgcatgataa cagacttctt ccctgaagac attactgtgg agtggcagtg gaatgggcag1141ccagcggaga actacaagaa cactcagccc atcatggaca cagatggctc ttacttcgtc1201tacagcaagc tcaatgtgca gaagagcaac tgggaggcag gaaatacttt cacctgctct1261gtgttacatg agggcctgca caaccaccat actgagaaga gcctctccca ctctcctggt1321aaaProtein Sequence Defining the Full Length Heavy Chain Sequence (Heavy ChainVariable Region and IgG1 Constant Region) of 29B06(SEQ ID NO: 109)1evqlqesgps lvkpsqtlsl tcsvtgdsit sgywnwirkf pgnkleymgy isysgktyyn61pslksrisit rdtsknhyyl qlisvtaedt atyycarsky dyamdywgqg tsvtvssakt121tppsvyplap gsaaqtnsmv tlgclvkgyf pepvtvtwns gslssgvhtf pavlqsdlyt181lsssvtvpss twpsetvtcn vahpasstkv dkkivprdcg ckpcictvpe vssvfifppk241pkdvltitlt pkvtcvvvdi skddpevqfs wfvddvevht aqtqpreeqf nstfrsvsel301pimhqdwlng kefkcrvnsa afpapiekti sktkgrpkap qvytipppke qmakdkvslt361cmitdffped itvewqwngq paenykntqp imdtdgsyfv ysklnvqksn weagntftcs421vlheglhnhh tekslshspg kNucleic Acid Sequence Encoding the Full Length Light Chain Sequence (KappaChain Variable Region and Constant Region) of 29B06(SEQ ID NO: 110)1gacattgtgc tgacccaatc tccagcttct ttggctgtgt ctctaggaca gagggccacc61atctcctgca gagccagcga aattgttgat aattttggca ttagttttat gaactggttc121caacagaaac caggacagcc acccaaactc ctcatctatg ctgcatccaa ccaaggatcc181ggggtccctg ccaggtttag tggcagtggg tctgggacag acttcagcct caacatccat241cctgtggagg aggatgatac tgcaatgtat ttctgtcagc aaagtaagga ggttcctccg301acgttcggtg gaggcaccaa gctggaaatc aaacgggctg atgctgcacc aactgtatcc361atcttcccac catccagtga gcagttaaca tctggaggtg cctcagtcgt gtgcttcttg421aacaacttct accccaaaga catcaatgtc aagtggaaga ttgatggcag tgaacgacaa481aatggcgtcc tgaacagttg gactgatcag gacagcaaag acagcaccta cagcatgagc541agcaccctca cgttgaccaa ggacgagtat gaacgacata acagctatac ctgtgaggcc601actcacaaga catcaacttc acccattgtc aagagcttca acaggaatga gtgtProtein Sequence Defining the Full Length Light Chain Sequence (Kappa ChainVariable Region and Constant Region) of 29B06(SEQ ID NO: 111)1divltqspas lavslgqrat iscraseivd nfgisfmnwf qqkpgqppkl liyaasnqgs61gvparfsgsg sgtdfslnih pveeddtamy fcqqskevpp tfgggtklei kradaaptvs121ifppsseqlt sggasvvcfl nnfypkdinv kwkidgserq ngvinswtdq dskdstysms181stltltkdey erhnsytcea thktstspiv ksfnrnec Table 4 shows the correspondence between the full-length sequences of the antibodies discussed in this Example with those presented in the Sequence Listing. TABLE 4SEQ ID NO.Nucleic Acid or Protein9207F01 Heavy Variable + IgG1 Constant-nucleic acid9307F01 Heavy Variable + IgG1 Constant-protein9407F01 Kappa Variable + Constant-nucleic acid9507F01 Kappa Variable + Constant-protein9612B11 Heavy Variable + IgG1 Constant-nucleic acid9712B11 Heavy Variable + IgG1 Constant-protein9812B11 Kappa Variable + Constant-nucleic acid9912B11 Kappa Variable + Constant-protein10017F06 Heavy Variable + IgG2A Constant-nucleic acid10117F06 Heavy Variable + IgG2A Constant-protein10217F06 Lambda Variable + Constant (IGLC2)-nucleic acid10317F06 Lambda Variable + Constant (IGLC2)-protein10418H09 Heavy Variable + IgG1 Constant-nucleic acid10518H09 Heavy Variable + IgG1 Constant-protein10618H09 Lambda Variable + Constant (IGLC1)-nucleic acid10718H09 Lambda Variable + Constant (IGLC1)-protein10829B06 Heavy Variable + IgG1 Constant-nucleic acid10929B06 Heavy Variable + IgG1 Constant-protein11029B06 Kappa Variable + Constant-nucleic acid11129B06 Kappa Variable + Constant-protein Example 5 Binding Affinities The binding affinities and kinetics of binding of antibodies 07F01, 29B06, 17F06, 18H09, and 12B11 to recombinant human RON-ECD/mFc fusion protein (rhRON ECD/mFc) and recombinant human RON SEMA and PSI domains (rhRON SEMA+PSI) (R&D Systems, Inc., Minneapolis, Minn.) were measured by surface plasmon resonance, using a BIACORE® T100 instrument (GE Healthcare, Piscataway, N.J.). Rabbit anti-mouse IgGs (GE Healthcare) were immobilized on carboxymethylated dextran CM4 sensor chips (GE Healthcare) by amine coupling, according to a standard protocol. Analyses were performed at 25° C. and 37° C., using PBS containing 0.05% surfactant P20 as running buffer. The antibodies were captured in individual flow cells at a flow rate of 10 μl/min. Injection time was varied for each antibody to yield an Rmax between 30 and 60 RU. 250 μg/mL mouse Fc were injected at 30 μl/min for 120 seconds to block non-specific binding of antibodies to Fc portion of the protein when needed. Buffer, rhRon ECD/mFc or rhRON SEMA+PSI diluted in running buffer was injected sequentially over a reference surface (no antibody captured) and the active surface (antibody to be tested) for 300 seconds at 60 μl/minute. The dissociation phase was monitored for up to 3600 seconds. The surface was then regenerated with two 60-second injections of 10 mM Glycine-HCl, pH 1.7, at a flow rate of 60 μl/min. The rhRON ECD/mFc or rhRON SEMA+PSI concentration range tested was 0.625 nM to 20 nM. Kinetic parameters were determined using the kinetic function of the BIAevaluation software (GE Healthcare) with double reference subtraction. Kinetic parameters for each antibody, k a (association rate constant), k d (dissociation rate constant) and K D (equilibrium dissociation constant) were determined. Kinetic values of the monoclonal antibodies on rhRON ECD/mFc at 25° C. and 37° C. are summarized in Table 5. TABLE 5Antibody Binding to rhRON ECD/mFcMeasurements at 25° C.Measurements at 37° C.Antibodyka (1/Ms)kd (1/s)K D (M)nka (1/Ms)kd (1/s)K D (M)n07F01AVG4.0E+059.3E−052.3E−1042.1E+063.5E−042.1E−103STDEV7.1E+045.5E−063.4E−112.4E+062.8E−047.1E−1129B06AVG2.0E+051.3E−046.5E−1032.3E+067.0E−042.8E−103STDEV3.5E+041.0E−051.2E−101.3E+064.8E−047.8E−1117F06AVG1.7E+054.6E−08*2.9E−13*31.4E+052.4E−052.1E−103STDEV4.8E+043.3E−081.7E−133.1E+042.2E−052.4E−1018H09AVG3.3E+055.7E−052.2E−1031.8E+067.0E−044.0E−101STDEV1.5E+052.3E−051.6E−1012B11AVG1.2E+055.9E−055.0E−1032.0E+052.0E−041.1E−093STDEV2.8E+041.7E−054.6E−111.1E+053.8E−054.6E−10*Outside instrument limit of detection The data in Table 5 demonstrate that antibodies 07F01, 29B06, 17F06, 18H09, and 12B11 bind rhRON ECD/mFc with a K D of about 1 nM or less, 750 pM or less, 650 pM or less, 600 pM or less, 500 pM or less, 400 pM or less, 300 pM or less, 250 pM or less, 200 pM or less, 150 pM or less, 100 pM or less, or 50 pM or less. Kinetic values of the monoclonal antibodies on rhRON SEMA+PSI at 25° C. and 37° C. are summarized in Table 6. TABLE 6Antibody Binding to rhRON SEMA + PSIMeasurements at 25° C.Measurements at 37° C.Antibodyka (1/Ms)kd (1/s)K D (M)nka (1/Ms)kd (1/s)K D (M)n07F01AVG5.2E+063.6E−048.8E−1132.0E+068.0E−044.0E−103STDEV7.0E+064.3E−043.3E−112.1E+057.5E−058.3E−1229B06AVG4.2E+057.0E−051.8E−1035.2E+056.9E−041.3E−093STDEV1.2E+058.7E−066.1E−114.7E+044.9E−059.9E−1117F06AVG1.9E+051.4E−069.0E−1242.6E+052.1E−051.3E−103STDEV3.6E+041.7E−061.1E−111.2E+052.9E−051.9E−1018H09AVG4.4E+053.8E−068.6E−1235.8E+051.2E−042.2E−102STDEV2.7E+046.3E−061.4E−117.6E+045.3E−051.2E−1012B11AVGNo binding2No binding The data in Table 6 demonstrate that antibodies 07F01, 29B06, 17F06 and 18H09 bind rhRON SEMA+PSI with a K D of about 1 nM or less, 750 pM or less, 650 pM or less, 600 pM or less, 500 pM or less, 400 pM or less, 300 pM or less, 250 pM or less, 200 pM or less, 150 pM or less, 100 pM or less, 75 pM or less, 50 pM or less, or 10 pM or less. Antibody 12B11 did not bind to rhRON SEMA+PSI. Binding to cell surface human wild-type RON and the delta 160 RON variant by antibodies 29B06 and 07F01 was measured at 4° C., using Fluorescence Activated Cell Sorting (FACS). PC3 cells expressing the human wild-type RON, and HT29 cells expressing the delta 160 variant, were harvested using cell dissociation buffer (Invitrogen), washed twice with FACS buffer (PBS with 0.5% BSA), and treated for 10 minutes with Cyto Q Antibody diluent and FC receptor block (Innovex Biosciences, Richmond, Calif.). Purified antibodies were diluted in FACS buffer over a concentration range from 0.02 nM to 40 nM. Cells were incubated with 100 μl of antibody for one hour, washed with FACS buffer three times, and incubated for 45 minutes with goat anti-mouse PE-conjugated antibody (Jackson ImmunoResearch Laboratories, West Grove, Pa.). Cells were washed three times with FACS buffer, resuspended in 300 μl of FACS buffer, and analyzed using a Beckman Coulter Cytomics FC 500 FACS instrument. Results are summarized in Table 7. TABLE 729B0607F01Human RON - K D (nM)0.1330.032Human RON - K D range (nM)0.089-0.1770.025-0.039Delta 160 RON - K D (nM)0.1460.024Delta 160 RON - K D range (nM)0.100-0.1920.020-0.029 The results in Table 7 demonstrate that antibodies 29B06 and 07F01 bind both wild-type RON and the delta 160 RON variant on the cell surface with similar affinity. Example 6 Cell Surface Binding Binding to cell surface wild-type RON and delta 160 RON at 4° C. was determined for antibodies 07F01, 12B11, 17F06, 18H09, and 29B06, using FACS. Cells expressing wild-type RON (PC3), and cells expressing delta 160 RON (HT-29), were harvested using cell dissociation buffer (Invitrogen), washed twice with FACS buffer (0.5% BSA PBS) and treated with CytoQ Antibody diluent and FC receptor block (Innovex). Purified antibodies were diluted at a concentration of 10 μg/ml, in FACS buffer. Cells were incubated with 100 μl of antibody mix for one hour, washed with FACS buffer three times, and incubated for 45 minutes with goat anti-mouse PE conjugated antibody (Jackson Immunoresearch Laboratories). Cells were washed three times with FACS buffer, resuspended in 300 μl of FACS buffer and analyzed using a Beckman Coulter Cytomics FC 500 FACS instrument. Percent binding as compared to murine IgG control is shown in Table 8. TABLE 8AntibodyPC3 % cell surface bindingHT-29 % cell surface binding07F0199.2999.0817F0699.0899.0029B0699.0699.0418H0999.0398.3312B1194.5288.64mIgG5.505.62 The results in Table 8 demonstrate that antibodies 07F01, 29B06, 17F06, 18H09, and 12B11 bind both wild-type RON and the delta 160 RON variant expressed on the surface of cells. Example 7 Receptor Internalization Antibody-stimulated receptor internalization was measured using FACS. PC3 cells were used to measure antibody-stimulated internalization of the wild-type RON receptor. HT-29 cells were used for the delta 160 RON receptor variant. Antibodies were first conjugated with R-Phycocerthrin (Prozyme cat. No. PJ31K). All cells were washed with PBS and treated with CytoQ Antibody diluent and FC receptor block (Innovex). Cells were incubated with the antibodies (10 μg/ml) for 2 hours at 37° C. or at 4° C. The cells were transferred to 4° C., washed with an acidic solution (0.5 M NaCl, 0.18 M Acetic Acid, 0.5% Na azide) to strip off the antibody remaining on the cell surface, and fixed using BD CYTOFIX/CYTOPERM™ Plus kit (BD Biosciences, cat. No. 555028) to measure antibodies retained intracellularly due to internalization. At 37° C., cells can undergo antibody-mediated receptor internalization, and the process is inhibited at low temperature of 4° C., thus serving as a baseline (no internalization). The cells were analyzed using a Beckman Coulter Cytomics FC 500 FACS instrument. A lowered anti-RON median fluorescent intensity (MFI) and a left shift of the histograms at 4° C. compared to that obtained at 37° C. indicate antibody-induced receptor internalization. Receptor internalization was quantified by subtracting MFI at 4° C. from that at 37° C. Results are summarized in Table 9. TABLE 9MFI @ 37° C. − MFI @MFI @ 37° C. − MFI @Antibody4° C. in PC-3 cells4° C. in HT-29 cellsmIgG control−0.15−0.0729B060.490.0007F010.210.2212B110.480.81 These results demonstrate that antibodies, 29B06, 07F01 and 12B11 induce receptor internalization in PC-3 cells expressing wild-type RON. Only 07F01 and 12B11 induce receptor internalization in HT-29 cells expressing delta 160 RON variant. Example 8 Inhibition of MSP-RON Binding Antibodies 07F01, 12B11, 17F06, 18H09, and 29B06 were tested for inhibition of MSP binding to hRON SEMA+PSI, as measured by electrochemiluminescence (ECL) assay as described in Example 3. The antibodies (concentration range: 0.006-10 μg/mL) were incubated for 45 minutes at room temperature. The MSP-hRON binding interaction was inhibited by antibodies 07F01, 18H06, and 29B06, but not by antibodies 17F06 and 12B11 ( FIG. 6 ). The IC 50 and maximum percent inhibition values for the antibodies (IgG1) are shown in Table 10. TABLE 10IC 50 (nM)Maximum Neutralization (%)AntibodyAverageStd DevAverageStd Devn07F010.260.0588.32.1318H090.910.1586.96.7329B061.110.0687.64.7312B11N/AN/A44.820317F06N/AN/A7.911.22 The results in Table 10 demonstrate that antibodies 07F01, 18H09 and 29B06 block MSP binding to hRON SEMA+PSI, while antibodies 12B11 and 17F06 do not. Example 9 Inhibition of Downstream Signaling by Anti-RON Antibodies Antibodies 07F01, 12B11, 17F06, 18H09, and 29B06 were tested for inhibition of MSP-dependent phosphorylation of ERK, a RON downstream signaling molecule using the cell-based assay described in Example 3. The antibodies (concentration range: 0.006-10 μg/mL) in RPMI were added to the cells and incubated for one hour at 37° C. Dose-dependent inhibition of ERK phosphorylation by antibodies 07F01, 12B11, 17F06, 18H09, and 29B06 is shown in Table 11 and FIG. 7 . TABLE 11AntibodyMean IC50 (nM)Std DevN07F010.070.02318H090.710.36329B060.440.27312B115.915.92317F060.960.43 The results in Table 11 and FIG. 7 demonstrate that antibodies 07F01, 18H09, 29B06, 12B11 and 17F06 inhibit MSP-induced ERK phosphorylation in T47D breast cancer cell line, even though 12B11 and 17F06 do not effectively block MSP binding to RON (see Examples 3 and 8). Example 10 Inhibition of MSP-Dependent Cell Migration Antibodies 07F01, 18H09, 29B06, 12B11 and 17F06 were tested for inhibition of MSP-dependent cell migration. HPAF-II pancreatic cancer cells (ATCC) were incubated overnight under low serum conditions (1% FBS, MEM). Cells were trypsinized, counted, and placed at a concentration of 50,000/well in 45 μl of 1% FBS/MEM in the upper chamber of a BD 96-well FLUOROBLOK™ plate (Becton Dickinson). Antibodies were added at a concentration of 2 μg/ml, and cells were incubated for 2 hours. The bottom chamber contained 1% FBS MEM (200 μl) and 1 nM MSP, and cells were incubated for 24 hours. The number of migrated cells was determined by the addition of Calcien Dye at 4 μg/ml final concentration to the bottom chamber, followed by a one-hour incubation. Fluorescence intensity was measured using a WALLAC 1420 VICTOR™. Baseline fluorescent measurements were done in the absence of MSP. Percent inhibition was determined by comparing antibody-treated and antibody-untreated samples to the baseline using the following formula: 100-(anti-RON antibody treated-baseline)/(control huIgG treated-baseline)*100. Results on inhibition of MSP-induced HPAFII cell migration by antibodies 07F01, 18H09, 29B06, 12B11, and 17F06 are summarized in Table 12 and FIG. 8 . TABLE 12Antibody (2 μg/ml)Percent Inhibition07F0195.6329B0696.7917F0670.7418H09106.9612B1198.93 The results in Table 12 demonstrate that antibodies 07F01, 18H09, 29B06, 12B11 and 17F06 inhibit MSP-dependent cell migration in HPAF-II pancreatic cancer cell lines, even though 12B11 and 17F06 do not effectively block MSP binding to RON. Example 11 Inhibition of Growth of Wild-Type RON-Dependent Tumor Model Inhibition of tumor growth was tested in a directed complementation model of wild-type RON-driven tumor growth. “Directed complementation” tumors were obtained as described in Robinson et al., U.S. Pat. No. 7,556,796. A cDNA encoding wild-type human RON was introduced into BH3 tumor cells by retroviral transfer. Transfected tumor cells were then implanted subcutaneously into recipient mice. Growth of the BH3 tumors was dependent on expression of an inducible HER2 gene, which was not induced. Therefore, tumors would grow only if the RON gene functionally complemented the uninduced HER2 gene. Growth of the directed complementation tumors was observed. Primary tumors were propagated in vivo to generate sufficient tumor material for drug efficacy studies. Quality control for the directed complemented tumors included RT-PCR for RON expression and immunohistochemistry (IHC) for protein expression. The tumors were stored as frozen archival aliquots of approximately 1.5×10 5 cells/vial. These tumors were thawed, washed once, resuspended in HBS+matrigel and injected subcutaneously. Tumor measurements were taken twice weekly using vernier calipers. Tumor volume was calculated using the formula: width×width×length/2. When tumors reached approximately 150 mm 3 , the mice were randomized into five groups of ten mice each. Each group (ten mice each) received one of the following antibody treatments: 07F01, 29B06, 12B11, or 18H09, or murine IgG control, all at 20 mg/kg. Treatment was administered by intra-peritoneal injection, twice weekly, for two weeks. Antibodies 29B06 and 07F01 resulted in tumor growth inhibition (“TGI”) greater than 50% (p<0.001), while antibodies 18H09 and 12B11 exhibited TGI of 25% and 29%, respectively ( FIG. 9 ). All treatments were well-tolerated with no significant loss in body weight. Pharmacodynamic changes in RON receptor levels after 29B06 and 07F01 treatment were evaluated. Tumors were treated with 20 mg/kg of the following antibodies: mIgG (control), 29B06 or 07F01 and tumors were harvested at 24 or 48 hours. After harvest, the tumors were lysed in standard RIPA buffer (Boston Bioproducts, cat. No. BP-115) containing protease inhibitors (Roche, catalog No. 04693159001) and phosphatase inhibitors I and II (Sigma, cat. Nos. P2350 and P5726). Lysates were cleared and protein concentration was measured. A Western blot for total RON was done using a polyclonal anti-RON antibody (Santa Cruz, cat. No. sc-322). The Western blot analysis showed that antibody 29B06 induced receptor degradation in vivo in RON-DC xenograft at 24 hours, and to a greater extent at 48 hours. Example 12 Inhibition of Growth of Delta 160 RON-Driven Tumor Model Inhibition of tumor growth by the antibodies was tested in a directed complementation model of delta 160 RON-driven tumor growth. The model was obtained as described in Example 11, except that the transfected cDNA encoded human delta 160 (oncogenic) form of RON. Growth of the directed complementation tumors was observed. Primary tumors were propagated in vivo to generate sufficient tumor material for drug efficacy studies. Quality control for the directed complimented tumors included RT-PCR for RON expression and IHC for protein expression. The tumors were stored as frozen archival aliquots of approximately 1.5×10 5 cells/vial. These tumors were thawed, washed once, resuspended in HBS plus matrigel, and injected subcutaneously. Tumor measurements were taken twice weekly. When tumors reached approximately 150 mm 3 , the mice were randomized into five groups of ten mice each. Each group (ten mice per group) received one of the following treatments: murine IgG control, 07F01, 29B06, 12B11, 17F06, and 18H09, all at 20 mg/kg. Treatment was administered by intra-peritoneal injection, twice weekly, for two weeks. Each treatment group showed similar tumor growth inhibition of greater than 60% (p<0.001) except for 18H09 (TGI 54%) as shown in FIG. 10 . All treatments were well-tolerated, with no significant loss in body weight. Example 13 Inhibition of Growth of NCI-H358 Lung Xenograft Tumor Model Inhibition of tumor growth by the 29B06 antibody was tested in an NCI-H358 lung xenograft model. The NCI-H358 cells were grown in culture at 37° C. in an atmosphere containing 5% CO 2 , using RMPI medium (Invitrogen) containing 10% FBS. Cells were inoculated subcutaneously into the flank of 8-week old female CB.17 SCID mice with 5×10 6 cells per mouse in 50% matrigel. Tumor measurements were taken twice weekly. When tumors reached approximately 150 mm 3 , the mice were randomized into two groups of ten mice each. Each group received one of the following treatments: murine IgG control or 29B06 at 40 mg/kg. Treatment was administered by intra-peritoneal injection three times per week, for three weeks. Antibody 29B06 treatment resulted in tumor growth inhibition of 70% (p<0.001) ( FIG. 11 ). Treatment was well-tolerated, with no significant loss in body weight. Example 14 Humanization of Anti-RON Antibodies A. Construction of Humanized and Chimeric Anti-RON Antibodies This Example describes the humanization of two murine antibodies, designated 07F01 and 29B06, and the characterization of the resulting humanized antibodies. The humanized anti-RON antibodies were designed using the SUPERHUMANIZATION™ method (Cephalon, Inc. (Arana Therapeutics Ltd.) and Hwang, W. Y. et al. (2005) METHODS 36:35-42), the CDR grafting method with back mutations (some human framework residues were changed to murine residues) (See e.g., U.S. Pat. Nos. 5,530,101; 5,693,761; 5,693,762; 5,585,089; 6,180,370; 7,022,500), or the HUMAN ENGINEERING™ method (Studnicka et al., Protein Eng. 1994 June; 7(6):805-14; also see, e.g., PCT Publication No. WO 93/11794 and U.S. Pat. Nos. 5,766,886; 5,770,196; 5,821,123; and 5,869,619). With the exception of heavy chain CDR1, the Kabat CDR definitions were used for CDR grafting onto human frameworks (SUPERHUMANIZATION™ and CDR grafting with back mutations). In some cases, a combination of Kabat and Chothia definitions were used for grafting heavy CDR1. In some cases, CDR residues (Kabat or Chothia definitions) were changed to human residues to increase humanness. Models of the murine antibodies were created using the SWISS-MODEL web server (swissmodel.expasy.org). Predicted residue contacts were determined using the Contact Map Analysis web server (ligin.weizmann.ac.il/cma/), and residue surface accessibility was determined using the Accessible Molecular Surface web server (swift.cmbi.ru.nl/servers/html/accessres.html). Residues were selected for back mutation based on predicted surface accessibility, contact with CDR residues, and involvement in the interface between heavy and light chains. Additionally, a cysteine residue present in the heavy chain CDR3 of 07F01 was changed to serine to prevent potential aggregation, and in some examples, a predicted N-linked glycosylation consensus site (N-X-S/T) in 07F01 heavy CDR2 (e.g., N58, Y59, T60) was mutated (e.g., T60A) to prevent any possible glycosylation. The designed amino acid sequences were converted to codon-optimized DNA sequences and synthesized by DNA2.0, Inc. to include (in the following order): 5′ HindIII restriction site, Kozak consensus sequence, amino terminal signal sequence, humanized variable region, human IgG1 or Kappa constant region, stop codon, and a 3′ EcoRI restriction site. The anti-RON antibody chains humanized according to the SUPERHUMANIZATION™ method, as described herein, are designated with the prefix “Sh” before the antibody chain name. The anti-RON antibody chains humanized by the CDR grafting method with back mutations, as described herein, are designated with the prefix “Hu” before the antibody chain name. The anti-RON antibody chains humanized by the HUMAN ENGINEERING™ method, as described herein, are designated with the prefix “HE” before the antibody chain name. The anti-RON antibody heavy chain 07F01 was humanized according to the SUPERHUMANIZATION™ method. Human germline sequence IGHV3-48*01 (also referred to herein as Hv3-48) was selected as the human heavy chain framework. In some embodiments, the human Hv3-48 heavy chain framework sequence was mutated at amino acid position 28 (e.g., D28T). Amino acid numbering is based on the Kabat numbering system. The anti-RON antibody light chain 07F01 was humanized according to the HUMAN ENGINEERING™ method. Human germline sequence IGKV1-9*01 was selected as the human light chain framework. The anti-RON antibody heavy chain 29B06 was humanized by the CDR grafting method with back mutations. Human germline sequence IGHV4-59*01 (also referred to herein as Hv4-59) was selected as the human framework. The human framework was back-mutated at amino acid positions 27, 30, 39, 44, 47, 48, 67, 71, and 78 to the murine sequence when the Kabat CDR definitions were used. The back-mutated human Hv4-59 framework sequence was further mutated to comprise at least one amino acid substitution at positions 27, 30, 48, 67, and 78. Amino acid substitutions in the back-mutated Hv4-59 framework sequence (e.g., amino acid substitution from a murine residue to a human residue, e.g., a human residue found in IGHV4-59) may be selected from the group consisting of D27G, T30S, M48I, I67V and Y78F. Amino acid numbering is based on the Kabat numbering system. The anti-RON antibody light chain 29B06 was humanized according to the SUPERHUMANIZATION™ method. Human germline sequence IGKV2-28*01 was selected as the human light chain framework. Chimeric (murine variable region and human constant region) 07F01 and 29B06 heavy (human IgG1) and light (human Kappa) chains were also constructed. The cysteine residue present in the heavy chain CDR3 of 07F01 was changed to serine to prevent potential aggregation. To generate chimeric antibodies, the murine variable regions were fused to the human constant region using overlap extension PCR, including (in the following order): 5′ HindIII restriction site, Kozak consensus sequence, amino terminal signal sequence, mouse variable region, human IgG1 or Kappa constant region, stop codon, and 3′ EcoRI restriction site. The humanized and chimeric heavy chains were subcloned into pEE6.4 (Lonza, Basel, Switzerland) via HindIII and EcoRI sites using IN-FUSION™ PCR cloning (Clontech, Mountain View, Calif.). The humanized and chimeric Kappa light chains were subcloned into pEE14.4 (Lonza) via HindIII and EcoRI sites using IN-FUSION™ PCR cloning. Humanized antibody chains or chimeric antibody chains were transiently transfected into 293T cells to produce antibody. Antibody was either purified or used in cell culture media supernatant for subsequent in vitro analysis. Binding of the chimeric and humanized antibodies to human RON was measured as described below. The results are summarized in Table 20. Additionally, some humanized antibody heavy and light chain combinations were stably expressed in CHOK1SV cells using the GS SYSTEM™ (Lonza) in order to produce large quantities of purified humanized antibody. A single expression vector was constructed by combining pEE6.4 and pEE14.4 based vectors. First, pEE6.4 containing full length humanized heavy chain cDNA was digested with NotI and SalI to isolate the hCMV-MIE promoter+full length humanized heavy chain cDNA+SV40 poly A fragment. This fragment was inserted into the pEE14.4 vector already containing full length humanized light chain cDNA via NotI/SalI sites, thus creating an expression vector that simultaneously expresses heavy and light chains. The combined heavy and light chain vector was linearized and transfected into CHOK1SV cells. Stable clones were selected in the presence of methionine sulfoximine. Each of the possible combinations of the humanized 07F01 immunoglobulin heavy chain and immunoglobulin light chain variable regions are set forth below in Table 13. TABLE 13Light Chain Variable RegionHeavy Chain Variable RegionHE L 07F01 Kv1-9 LightSh07F01 Hv3-48 Heavy VariableVariable(SEQ ID NO: 135)(SEQ ID NO: 139)HE L 07F01 Kv1-9 LightSh07F01 Hv3-48 D28T T60AVariableL63V E65G Heavy Variable(SEQ ID NO: 139)(SEQ ID NO: 137)Sh07F01 Kv1-9 F1 LightSh07F01 Hv3-48 Heavy VariableVariable(SEQ ID NO: 135)(SEQ ID NO: 141)Sh07F01 Kv1-9 F1 LightSh07F01 Hv3-48 D28T T60AVariableL63V E65G Heavy Variable(SEQ ID NO: 141)(SEQ ID NO: 137) Each of the possible combinations of the humanized 29B06 immunoglobulin heavy chain and immunoglobulin light chain variable regions are set forth below in Table 14. TABLE 14Light Chain Variable RegionHeavy Chain Variable RegionSh29B06 Kv2-28 Kappa VariableSh29B06 Hv4-59 Heavy Variable(SEQ ID NO: 149)(SEQ ID NO: 143)Sh29B06_Kv2-28 Kappa VariableHu29B06 Hv4-59 Heavy Variable(SEQ ID NO: 149)(SEQ ID NO: 145)Sh29B06 Kv2-28 Kappa VariableHu29B06 Hv4-59 D27G T30S M48I(SEQ ID NO: 149)I67V Y78F Heavy Variable(SEQ ID NO: 147) The nucleic acid sequences encoding and the protein sequences defining variable regions of the humanized 07F01 and 29B06 antibodies are summarized below (amino terminal signal peptide sequences are not shown). Sequences of the modified chimeric 07F01 heavy variable region in which the cysteine in CDR3 is changed to serine are also summarized below. CDR sequences (Kabat definition) are shown in bold and are underlined in the amino acid sequences. Nucleic Acid Sequence Encoding the Chimeric 07F01 C102S Heavy Chain VariableRegion(SEQ ID NO: 132)1gaggtgaagc ttctcgagtc tggaggtggc ctggtgcagc cgggtggatc cctgaaactc61tcctgtgcag cctcaggatt cgattttagt agacactgga tgagttgggt ccggctggct121ccagggaaag ggctagaatg gatcgcagaa attaatccag atagcagaac gataaactat181acgccatctc taaaggagaa attcatcatc tccagagaca acgccaaaaa ttcgctgttt241ctgcaaatga acagagtgag atctgaggac acagcccttt attactgtgc aagacgggta301agaattcatt actacggcgc tatggacagc tggggtcaag gaacctcagt caccgtctcc361tcaProtein Sequence Defining the Chimeric 07F01 C102S Heavy Chain Variable Region(SEQ ID NO: 133)1evkllesggg lvqpggslkl scaasgfdfs rhwms wvrla pgkglewia e inpdsrtiny61tpslke kfii srdnaknslf lqmnrvrsed talyycar rv rihyygamds wgqgtsvtvs121sNucleic Acid Sequence Encoding the Sh07F01 Hv3-48 Heavy Chain Variable Region(SEQ ID NO: 134)1gaggttcagc tggtagaatc cggaggaggg ttggtccaac ctggtggatc actcagactt61tcatgcgccg ccagcggctt tgacttctca cgacattgga tgagctgggt ccggcaggct121ccaggcaagg gcctcgagtg ggttagcgag atcaatccag acagcagaac cattaactat181acacccagtc tgaaggagcg gttcaccata agccgtgata atgccaagaa ctccctgtac241ttgcagatga actccttgcg cgctgaagat acagctgtgt actattgtgc aaggcgcgtg301cgaatccact attacggggc aatggattct tggggccagg gtactaccgt gactgtgagt361tctProtein Sequence Defining the Sh07F01 Hv3-48 Heavy Chain Variable Region(SEQ ID NO: 135)1evqlvesggg lvqpggslrl scaasgfdfs rhwms wvrga pgkglewvs e inpdsrtiny61tpslke rfti srdnaknsly lqmnslraed tavyycar rv rihyygamds wgqgttvtvs121sNucleic Acid Sequence Encoding the Sh07F01 Hv3-48 D28T T60A L63V E65GHeavy Chain Variable Region(SEQ ID NO: 136)1gaggttcagc tggtagaatc cggaggaggg ttggtccaac ctggtggatc actcagactt61tcatgcgccg ccagcggctt taccttctca cgacattgga tgagctgggt ccggcaggct121ccaggcaagg gcctcgagtg ggttagcgag atcaatccag acagcagaac cattaactat181gcccccagtg tgaagggccg gttcaccata agccgtgata atgccaagaa ctccctgtac241ttgcagatga actccttgcg cgctgaagat acagctgtgt actattgtgc aaggcgcgtg301cgaatccact attacggggc aatggattct tggggccagg gtactaccgt gactgtgagt361tctProtein Sequence Defining the Sh07F01 Hv3-48 D28T T60A L63V E65G HeavyChain Variable Region(SEQ ID NO: 137)1evqlvesggg lvqpggslrl scaasgftfs rhwms wvrqa pgkglewvs e inpdsrtiny61apsvkg rfti srdnaknsly lqmnslraed tavyycar rv rihyygamds wgqgttvtvs121sNucleic Acid Sequence Encoding the HE_L 07F01_Kv1-9 Kappa Chain VariableRegion(SEQ ID NO: 138)1gatatccagt tgactcagtc tcagtccttt gtgagtacat cagtgggcga cagggtcacc61gtgacctgcc gagcatcaca gaacgttgga agctctcttg tctggtatca gcaaaagcct121gggaagagcc ccaaaaccct catctattct gcttcctttc tgtactccgg cgtaccaagt181agattctctg gtagcggatc cgggacagag ttcactctca caattagcag tgtgcagcct241gaggatttcg ccgactactt ctgtcagcaa tacaataact atcccctgac ttttggtggc301ggcaccaaag tggaaatcaa gProtein Sequence Defining the HE L 07F01 Kv1-9 Kappa Chain Variable Region(SEQ ID NO: 139)1diqltqsqsf vstsvgdrvt vtc rasqnvg sslv wyqqkp gkspktliy s asflys gvps61rfsgsgsgte ftltissvqp edfadyfc gg ynnyplt fgg gtkveikNucleic Acid Sequence Encoding the sh07F01 Kv1-9 F1 Kappa Chain VariableRegion(SEQ ID NO: 140)1gacattcagc tgactcagtc gccgtcgttt ttgtcggcgt ccgtgggtga cagagtgact61atcacatgtc gcgcttcgca aaacgtcgga tcatcgcttg tgtggtatca gcagaaaccc121ggtaaagccc ctaagaccct catctattca gcgtcatttc tgtatagcgg ggtcccctca181cggttcagcg gatccggctc cgggaccgag ttcacactca ctatttcgag cttgcagccg241gaagattttg caacgtacta ctgccagcaa tacaataact acccactcac gttcggaggg301ggaacgaagg tagagatcaa gProtein Sequence Defining the sh07F01 Kv1-9 F1 Kappa Chain Variable Region(SEQ ID NO: 141)1diqltqspsf lsasvgdrvt itc rasqnvg sslv wyqqkp gkapktliy s asflys gvps61rfsgsgsgte ftltisslqp edfatyyc qq ynnyplt fgg gtkveikNucleic Acid Sequence Encoding the Sh29B06_Hv4-59 Heavy Chain VariableRegion(SEQ ID NO: 142)1caagttcagc tgcaagaatc cggaccagga ttggtcaaac cttcagagac actcagcctg61acttgcaccg tgagcggtgg cagcatatcc tccggttatt ggaactggat ccggcagcca121ccaggcaagg gcctcgagtg gattggctac atcagctata gcgggaaaac ctattacaac181cccagtctga agagccgagt gaccataagc gtcgatacaa gtaagaacca gttctccctg241aagctctcat ccgtgaccgc cgctgataca gctgtgtact attgtgcaag gtcaaagtat301gactacgcaa tggactattg gggccagggt actctggtga ctgtgagttc tProtein Sequence Defining the Sh29B06 Hv4-59 Heavy Chain Variable Region(SEQ ID NO: 143)1qvqlqesgpg lvkpsetlsl tctvsggsis sgvwn wirqp pgkglewig y i sysgktyyn61pslks rvtis vdtsknqfsl klssvtaadt avyycar sky dyamdy wgqg tlvtvssNucleic Acid Sequence Encoding the Hu29B06_Hv4-59 Heavy Chain VariableRegion(SEQ ID NO: 144)1caagttcagc tgcaagaatc cggaccagga ttggtcaaac ccagcgaaac actctctctt61acatgcaccg tgagcggcga ctctatcacc tcagggtatt ggaattggat tcggaaaccc121ccaggcaaga agctcgagta catgggttac atcagttaca gcgggaaaac ctactataac181cccagtctga agagcagaat caccataagc cgtgatacct ctaagaacca gtactccctg241aagctgagtt ccgtaacagc agctgataca gctgtgtact attgtgcaag gagtaagtat301gactacgcaa tggactattg gggccagggt actcttgtga ctgtgagttc tProtein Sequence Defining the Hu29B06_Hv4-59 Heavy Chain Variable Region(SEQ ID NO: 145)1qvqlqesgpg lvkpsetlsl tctvsgdsit sgvwn wirkp pgkkleymg y isysgktyyn61pslks ritis rdtsknqysl klssvtaadt avyycar sky dyamdy wgqg tlvtvssNucleic Acid Sequence Encoding the Hu29B06 D27G T30S M48I I67V Y78F HeavyChain Variable Region(SEQ ID NO: 146)1caagttcagc tgcaagaatc cggaccagga ttggtcaaac cttcagagac actcagcctg61acttgcaccg tgagcggtgg cagcatatcc tccggttatt ggaactggat ccggaagcca121ccaggcaaga agctcgagta cattggctac atcagctata gcgggaaaac ctattacaac181cccagtctga agagccgagt gaccataagc agggatacaa gtaagaacca gttctccctg241aagctctcat ccgtgaccgc cgctgataca gctgtgtact attgtgcaag gtcaaagtat301gactacgcaa tggactattg gggccagggt actctggtga ctgtgagttc tProtein Sequence Defining the Hu29B06 D27G T30S M48I I67V Y78F Heavy ChainVariable Region(SEQ ID NO: 147)1qvqlqesgpg lvkpsetlsl tctvsggsis sgvwn wirkp pgkkleyig y isysgktyyn61pslks rvtis rdtsknqfsl klssvtaadt avyycar sky dyamdy wgqg tlvtvssNucleic Acid Sequence Encoding the Sh29B06 Kv2-28 Kappa Chain VariableRegion(SEQ ID NO: 148)1gatatcgtta tgacccagag cccacttagt ttgcctgtta ctcctggcga gcctgccagt61atttcttgcc gtgctagcga aatcgtggat aactttggta tatcattcat gaattggtat121ctccaaaaac ctggccaaag cccccagctc cttatctacg ccgctagcaa ccaggggtcc181ggggtacctg atagattttc aggcagcggc tctggaaccg acttcacact gaagatttcc241cgggtggagg ccgaggacgt gggcgtgtac tattgtcaac agtccaagga agtccctccc301actttcggcg gtgggacaaa ggttgagatt aagProtein Sequence Defining the Sh29B06 Kv2-28 Kappa Chain Variable Region(SEQ ID NO: 149)1divmtqspls lpvtpgepas isc raseivd nfgisfmn wy lqkpgqspql liy aasnqgs61gvpdrfsgsg sgtdftlkis rveaedvgvy yc qqskevpp t fgggtkvei k The amino acid sequences defining the immunoglobulin heavy chain variable regions for the antibodies produced in Example 14 are aligned in FIGS. 12A and 12B . Amino terminal signal peptide sequences (for proper expression/secretion) are not shown. CDR 1 , CDR 2 , and CDR 3 (Kabat definition) are identified by boxes. FIGS. 13A and 13B show an alignment of the separate CDR 1 , CDR 2 , and CDR 3 sequences for each of the variable region sequences shown in FIGS. 12A and 12B , respectively. The amino acid sequences defining the immunoglobulin light chain variable regions for the antibodies in Example 14 are aligned in FIGS. 14A and 14B . Amino terminal signal peptide sequences (for proper expression/secretion) are not shown. CDR 1 , CDR 2 and CDR 3 are identified by boxes. FIGS. 15A and 15B show an alignment of the separate CDR 1 , CDR 2 , and CDR 3 sequences for each of the variable region sequences shown in FIGS. 14A and 14B , respectively. Table 15 is a concordance chart showing the SEQ ID NO. of each sequence discussed in this Example. TABLE 15SEQ. ID NO.Nucleic Acid or Protein132Chimeric 07F01 C102S Heavy Chain Variable Region-nucleic acid133Chimeric 07F01 C102S Heavy Chain Variable Region-protein5Chimeric 07F01 C102S Heavy Chain CDR 16Chimeric 07F01 C102S Heavy Chain CDR 2123Chimeric 07F01 C102S Heavy Chain CDR 3134Sh07F01 Hv3-48 Heavy Chain Variable Region-nucleicacid135Sh07F01 Hv3-48 Heavy Chain Variable Region-protein5Sh07F01 Hv3-48 Heavy Chain CDR 16Sh07F01 Hv3-48 Heavy Chain CDR 2123Sh07F01 Hv3-48 Heavy Chain CDR 3136Sh07F01 Hv3-48 D28T T60A L63V E65G Heavy ChainVariable Region-nucleic acid137Sh07F01 Hv3-48 D28T T60A L63V E65G Heavy ChainVariable Region-protein5Sh07F01 Hv3-48 D28T T60A L63V E65G Heavy ChainCDR 1122Sh07F01 Hv3-48 D28T T60A L63V E65G Heavy ChainCDR 2123Sh07F01 Hv3-48 D28T T60A L63V E65G Heavy ChainCDR 3138HE L 07F01 Kv1-9 Light (kappa) Chain VariableRegion-nucleic acid139HE L 07F01 Kv1-9 Light (kappa) Chain VariableRegion-protein130HE L 07F01 Kv1-9 Light (kappa) Chain CDR 1131HE L 07F01 Kv1-9 Light (kappa) Chain CDR 210HE L 07F01 Kv1-9 Light (kappa) Chain CDR 3140Sh07F01 Kv1-9 F1 Light (kappa) Chain VariableRegion-nucleic acid141Sh07F01 Kv1-9 F1 Light (kappa) Chain VariableRegion-protein130Sh07F01 Kv1-9 F1 Light (kappa) Chain CDR 1131Sh07F01 Kv1-9 F1 Light (kappa) Chain CDR 210Sh07F01 Kv1-9 F1 Light (kappa) Chain CDR 3142Sh29B06 Hv4-59 Heavy Chain Variable Region-nucleicacid143Sh29B06 Hv4-59 Heavy Chain Variable Region-protein45Sh29B06 Hv4-59 Heavy Chain CDR 146Sh29B06 Hv4-59 Heavy Chain CDR 247Sh29B06 Hv4-59 Heavy Chain CDR 3144Hu29B06 Hv4-59 Heavy Chain Variable Region-nucleicacid145Hu29B06 Hv4-59 Heavy Chain Variable Region-protein45Hu29B06 Hv4-59 Heavy Chain CDR 146Hu29B06 Hv4-59 Heavy Chain CDR 247Hu29B06 Hv4-59 Heavy Chain CDR 3146Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F HeavyChain Variable Region-nucleic acid147Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F HeavyChain Variable Region-protein45Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F HeavyChain CDR 146Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F HeavyChain CDR 247Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F HeavyChain CDR 3148Sh29B06 Kv2-28 Light (kappa) Chain VariableRegion-nucleic acid149Sh29B06 Kv2-28 Light (kappa) Chain VariableRegion-protein48Sh29B06 Kv2-28 Light (kappa) Chain CDR 149Sh29B06 Kv2-28 Light (kappa) Chain CDR 250Sh29B06 Kv2-28 Light (kappa) Chain CDR 3 Humanized monoclonal antibody heavy chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 16. TABLE 16CDR1CDR2CDR3Kabat07F01RHWMSEINPDSRTINYTPSLKERVRIHYYGAMDC(SEQ ID NO: 5)(SEQ ID NO: 6)(SEQ ID NO: 7)Chimeric 07F01RHWMSEINPDSRTINYTPSLKERVRIHYYGAMDSC102S(SEQ ID NO: 5)(SEQ ID NO: 6)(SEQ ID NO: 123)Sh07F01 Hv3-RHWMSEINPDSRTINYTPSLKERVRIHYYGAMDS48(SEQ ID NO: 5)(SEQ ID NO: 6)(SEQ ID NO: 123)Sh07F01 Hv3-RHWMSEINPDSRTINYAPSVKGRVRIHYYGAMDS48 D28T T60A(SEQ ID NO: 5)(SEQ ID NO: 122)(SEQ ID NO: 123)L63V E65G29B06SGYWNYISYSGKTYYNPSLKSSKYDYAMDY (SEQ(SEQ ID NO: 45)(SEQ ID NO: 46)ID NO: 47)Sh29B06 Hv4-SGYWNYISYSGKTYYNPSLKSSKYDYAMDY (SEQ59(SEQ ID NO: 45)(SEQ ID NO: 46)ID NO: 47)Hu29B06 Hv4-SGYWNYISYSGKTYYNPSLKSSKYDYAMDY (SEQ59(SEQ ID NO: 45)(SEQ ID NO: 46)ID NO: 47)Hu29B06 Hv4-59SGYWNYISYSGKTYYNPSLKSSKYDYAMDY (SEQD27G T30S(SEQ ID NO: 45)(SEQ ID NO: 46)ID NO: 47)M48I I67V Y78FChothia07F01GFDFSRHNPDSRTRVRIHYYGAMDC(SEQ ID NO: 51)(SEQ ID NO: 52)(SEQ ID NO: 7)Chimeric 07F01GFDFSRHNPDSRTRVRIHYYGAMDSC102S(SEQ ID NO: 51)(SEQ ID NO: 52)(SEQ ID NO: 125)Sh07F01 Hv3-GFDFSRHNPDSRTRVRIHYYGAMDS48(SEQ ID NO: 51)(SEQ ID NO: 52)(SEQ ID NO: 125)Sh07F01 Hv3-GFTFSRHNPDSRTRVRIHYYGAMDS48 D28T T60A(SEQ ID NO: 124)(SEQ ID NO: 52)(SEQ ID NO: 125)L63V E65G29B06GDSITSGSYSGKSKYDYAMDY(SEQ ID NO: 59)(SEQ ID NO: 60)(SEQ ID NO: 47)Sh29B06 Hv4-GGSISSGSYSGKSKYDYAMDY59(SEQ ID NO: 126)(SEQ ID NO: 60)(SEQ ID NO: 47)Hu29B06 Hv4-GDSITSGSYSGKSKYDYAMDY59(SEQ ID NO: 59)(SEQ ID NO: 60)(SEQ ID NO: 47)Hu29B06 Hv4-GGSISSGSYSGKSKYDYAMDY59 D27G T30S(SEQ ID NO: 126)(SEQ ID NO: 60)(SEQ ID NO: 47)M48I I67VY78FIMGT07F01GFDFSRHWINPDSRTIARRVRIHYYGAMDC(SEQ ID NO: 61)(SEQ ID NO: 62)(SEQ ID NO: 63)Chimeric 07F01GFDFSRHWINPDSRTIARRVRIHYYGAMDSC102S(SEQ ID NO: 61)(SEQ ID NO: 62)(SEQ ID NO: 128)Sh07F01 Hv3-GFDFSRHWINPDSRTIARRVRIHYYGAMDS48(SEQ ID NO: 61)(SEQ ID NO: 62)(SEQ ID NO: 128)Sh07F01 Hv3-GFTFSRHWINPDSRTIARRVRIHYYGAMDS48 D28T T60A(SEQ ID NO: 127)(SEQ ID NO: 62)(SEQ ID NO: 128)L63V E65G29B06GDSITSGYISYSGKTARSKYDYAMDY(SEQ ID NO: 73)(SEQ ID NO: 74)(SEQ ID NO: 75)Sh29B06 Hv4-GGSISSGYISYSGKTARSKYDYAMDY59(SEQ ID NO: 129)(SEQ ID NO: 74)(SEQ ID NO: 75)Hu29B06 Hv4-GDSITSGYISYSGKTARSKYDYAMDY59(SEQ ID NO: 73)(SEQ ID NO: 74)(SEQ ID NO: 75)Hu29B06 Hv4-GGSISSGYISYSGKTARSKYDYAMDY59 D27G T30S(SEQ ID NO: 129)(SEQ ID NO: 74)(SEQ ID NO: 75)M48I I67VY78F Humanized monoclonal antibody Kappa light chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 17. TABLE 17CDR1CDR2CDR3Kabat/Chothia07F01KASQNVGSSLVSASFRYSQQYNNYPLT(SEQ ID NO: 8)(SEQ ID NO: 9)(SEQ ID NO: 10)HE L 07F01 Kv1-9RASQNVGSSLVSASFLYSQQYNNYPLT(SEQ ID NO: 130)(SEQ ID NO: 131)(SEQ ID NO: 10)Sh07F01 Kv1-9 F1RASQNVGSSLVSASFLYSQQYNNYPLT(SEQ ID NO: 130)(SEQ ID NO: 131)(SEQ ID NO: 10)29B06RASEIVDNFGISFMNAASNQGSQQSKEVPPT(SEQ ID NO: 48)(SEQ ID NO: 49)(SEQ ID NO: 50)Sh29B06 Kv2-28RASEIVDNFGISFMNAASNQGSQQSKEVPPT(SEQ ID NO: 48)(SEQ ID NO: 49)(SEQ ID NO: 50)IMG07F01QNVGSSSASQQYNNYPLT(SEQ ID NO: 76)(SEQ ID NO: 10)HE L 07F01 Kv1-9QNVGSSSASQQYNNYPLT(SEQ ID NO: 76)(SEQ ID NO: 10)Sh07F01 Kv1-9 F1QNVGSSSASQQYNNYPLT(SEQ ID NO: 76)(SEQ ID NO: 10)29B06EIVDNFGISFAASQQSKEVPPT(SEQ ID NO: 81)(SEQ ID NO: 50)Sh29B06 Kv2-28EIVDNFGISFAASQQSKEVPPT(SEQ ID NO: 81)(SEQ ID NO: 50) To create the complete chimeric and humanized heavy or kappa chain antibody sequences, each variable sequence above is combined with its respective human constant region. For example, a complete heavy chain comprises a heavy variable sequence followed by a human IgG1 heavy chain constant sequence. A complete kappa chain comprises a kappa variable sequence followed by the human kappa light chain constant sequence. Nucleic Acid Sequence Encoding the Human IgG1 Heavy Chain Constant Region(SEQ ID NO: 150)1gcctcaacaa aaggaccaag tgtgttccca ctcgccccta gcagcaagag tacatccggg61ggcactgcag cactcggctg cctcgtcaag gattattttc cagagccagt aaccgtgagc121tggaacagtg gagcactcac ttctggtgtc catacttttc ctgctgtcct gcaaagctct181ggcctgtact cactcagctc cgtcgtgacc gtgccatctt catctctggg cactcagacc241tacatctgta atgtaaacca caagcctagc aatactaagg tcgataagcg ggtggaaccc301aagagctgcg acaagactca cacttgtccc ccatgccctg cccctgaact tctgggcggt361cccagcgtct ttttgttccc accaaagcct aaagatactc tgatgataag tagaacaccc421gaggtgacat gtgttgttgt agacgtttcc cacgaggacc cagaggttaa gttcaactgg481tacgttgatg gagtcgaagt acataatgct aagaccaagc ctagagagga gcagtataat541agtacatacc gtgtagtcag tgttctcaca gtgctgcacc aagactggct caacggcaaa601gaatacaaat gcaaagtgtc caacaaagca ctcccagccc ctatcgagaa gactattagt661aaggcaaagg ggcagcctcg tgaaccacag gtgtacactc tgccacccag tagagaggaa721atgacaaaga accaagtctc attgacctgc ctggtgaaag gcttctaccc cagcgacatc781gccgttgagt gggagagtaa cggtcagcct gagaacaatt acaagacaac ccccccagtg841ctggatagtg acgggtcttt ctttctgtac agtaagctga ctgtggacaa gtcccgctgg901cagcagggta acgtcttcag ctgttccgtg atgcacgagg cattgcacaa ccactacacc961cagaagtcac tgagcctgag cccagggaagProtein Sequence Defining the Human IgG1 Heavy Chain Constant Region(SEQ ID NO: 151)1astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvs wnsgaltsgv htfpavlqss61glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvep kscdkthtcp pcpapellgg121psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnw yvdgvevhna ktkpreeqyn181styrvvsvlt vlhqdwlngk eykckvsnka lpapiektis kakgqprepq vytlppsree241mtknqvsltc lvkgfypsdi avewesngqp ennykttppv ldsdgsffly skltvdksrw301qqgnvfscsv mhealhnhyt qkslslspgkNucleic Acid Sequence Encoding the Human Kappa Light Chain Constant Region(used for chimeric antibodies)(SEQ ID NO: 152)1cgcacagtcg ccgctccctc cgtgttcatc tttccaccaa gtgatgagca actgaagtct61ggtactgctt cagtcgtgtg tctgctgaac aatttctacc ctcgagaagc caaagtccaa121tggaaggtag acaacgcact gcagtccggc aatagccaag aatcagttac cgaacaggat181tcaaaggaca gtacatattc cctgagcagc actctgaccc tgtcaaaggc cgattacgag241aaacacaagg tctatgcttg cgaagtgaca catcagggac tgtccagccc agtgacaaaa301tcttttaacc gtggggagtg tNucleic Acid Sequence Encoding the Human Kappa Light Chain Constant Region(used for humanized antibodies)(SEQ ID NO: 153)1cgcacagttg ctgcccccag cgtgttcatt ttcccaccta gcgatgagca gctgaaaagc61ggtactgcct ctgtcgtatg cttgctcaac aacttttacc cacgtgaggc taaggtgcag121tggaaagtgg ataatgcact tcaatctgga aacagtcaag agtccgtgac agaacaggac181agcaaagact caacttattc actctcttcc accctgactc tgtccaaggc agactatgaa241aaacacaagg tatacgcctg cgaggttaca caccagggtt tgtctagtcc tgtcaccaag301tccttcaata ggggcgaatg tProtein Sequence Defining the Human Kappa Light Chain Constant Region (used forchimeric and humanized antibodies)(SEQ ID NO: 154)1rtvaapsvfi fppsdeqlks gtasvvclln nfypreakvq wkvdnalqsg nsqesvteqd61skdstyslss tltlskadye khkvyacevt hqglsspvtk sfnrgec The following sequences represent the actual or contemplated full length heavy and light chain sequence (i.e., containing both the variable and constant regions sequences) for each antibody described in this Example. Signal sequences for proper secretion of the antibodies (e.g., signal sequences at the 5′ end of the DNA sequences or the amino terminal end of the protein sequences) are not shown in the full length heavy and light chain sequences disclosed herein and are not included in the final secreted protein. Also not shown are stop codons for termination of translation required at the 3′ end of the DNA sequences. It is within ordinary skill in the art to select a signal sequence and/or a stop codon for expression of the disclosed full length IgG heavy chain and light chain sequences. It is also contemplated that the variable region sequences can be ligated to other constant region sequences to produce active full length IgG heavy and light chains. Nucleic Acid Sequence Encoding the Full Length Chimeric 07F01 C102S HeavyChain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region)(SEQ ID NO: 155)1gaggtgaagc ttctcgagtc tggaggtggc ctggtgcagc cgggtggatc cctgaaactc61tcctgtgcag cctcaggatt cgattttagt agacactgga tgagttgggt ccggctggct121ccagggaaag ggctagaatg gatcgcagaa attaatccag atagcagaac gataaactat181acgccatctc taaaggagaa attcatcatc tccagagaca acgccaaaaa ttcgctgttt241ctgcaaatga acagagtgag atctgaggac acagcccttt attactgtgc aagacgggta301agaattcatt actacggcgc tatggacagc tggggtcaag gaacctcagt caccgtctcc361tcagcctcaa caaaaggacc aagtgtgttc ccactcgccc ctagcagcaa gagtacatcc421gggggcactg cagcactcgg ctgcctcgtc aaggattatt ttccagagcc agtaaccgtg481agctggaaca gtggagcact cacttctggt gtccatactt ttcctgctgt cctgcaaagc541tctggcctgt actcactcag ctccgtcgtg accgtgccat cttcatctct gggcactcag601acctacatct gtaatgtaaa ccacaagcct agcaatacta aggtcgataa gcgggtggaa661cccaagagct gcgacaagac tcacacttgt cccccatgcc ctgcccctga acttctgggc721ggtcccagcg tctttttgtt cccaccaaag cctaaagata ctctgatgat aagtagaaca781cccgaggtga catgtgttgt tgtagacgtt tcccacgagg acccagaggt taagttcaac841tggtacgttg atggagtcga agtacataat gctaagacca agcctagaga ggagcagtat901aatagtacat accgtgtagt cagtgttctc acagtgctgc accaagactg gctcaacggc961aaagaataca aatgcaaagt gtccaacaaa gcactcccag cccctatcga gaagactatt1021agtaaggcaa aggggcagcc tcgtgaacca caggtgtaca ctctgccacc cagtagagag1081gaaatgacaa agaaccaagt ctcattgacc tgcctggtga aaggcttcta ccccagcgac1141atcgccgttg agtgggagag taacggtcag cctgagaaca attacaagac aaccccccca1201gtgctggata gtgacgggtc tttctttctg tacagtaagc tgactgtgga caagtcccgc1261tggcagcagg gtaacgtctt cagctgttcc gtgatgcacg aggcattgca caaccactac1321acccagaagt cactgagcct gagcccaggg aagProtein Sequence Defining the Full Length Chimeric 07F01 C102S Heavy Chain(Mouse Heavy Chain Variable Region and Human IgG1 Constant Region)(SEQ ID NO: 156)1evkllesggg lvqpggslkl scaasgfdfs rhwmswvrla pgkglewiae inpdsrtiny61tpslkekfii srdnaknslf lqmnrvrsed talyycarrv rihyygamds wgqgtsvtvs121sastkgpsvf plapssksts ggtaalgclv kdyfpepvtv swnsgaltsg vhtfpavlqs181sglyslssvv tvpssslgtq tyicnvnhkp sntkvdkrve pkscdkthtc ppcpapellg241gpsvflfppk pkdtlmisrt pevtcvvvdv shedpevkfn wyvdgvevhn aktkpreeqy301nstyrvvsvl tvlhqdwlng keykckvsnk alpapiekti skakgqprep qvytlppsre361emtknqvslt clvkgfypsd iavewesngq pennykttpp vldsdgsffl yskltvdksr421wqqgnvfscs vmhealhnhy tqkslslspg kNucleic Acid Sequence Encoding the Full Length Chimeric 07F01 Light Chain(Mouse Kappa Chain Variable Region and Human Kappa Constant Region)(SEQ ID NO: 157)1gacattgtgt tgacccagtc tcaaaaaatc gtgtccacat cagtaggagc cagggtcagc61gtcacctgca aggccagtca gaatgtgggt tctagtttag tctggtatca acagaaacca121ggtcaatctc ctaaaacact gatttactcg gcatccttcc ggtacagtgg agtccctgat181cgcttcacag gcagtggatc tgggacagat ttcactctca ccatcagcaa tgtgcagtct241gaagacttgg cagattattt ctgtcaacaa tataataact atccgctcac gttcggtgct301gggaccaagc tggagctgaa acgcacagtc gccgctccct ccgtgttcat ctttccacca361agtgatgagc aactgaagtc tggtactgct tcagtcgtgt gtctgctgaa caatttctac421cctcgagaag ccaaagtcca atggaaggta gacaacgcac tgcagtccgg caatagccaa481gaatcagtta ccgaacagga ttcaaaggac agtacatatt ccctgagcag cactctgacc541ctgtcaaagg ccgattacga gaaacacaag gtctatgctt gcgaagtgac acatcaggga601ctgtccagcc cagtgacaaa atcttttaac cgtggggagt gtProtein Sequence Defining the Full Length Chimeric 07F01 Light Chain (MouseKappa Chain Variable Region and Human Kappa Constant Region)(SEQ ID NO: 158)1divltqsqki vstsvgarvs vtckasqnvg sslvwyqqkp gqspktliys asfrysgvpd61rftgsgsgtd ftltisnvqs edladyfcqq ynnypltfga gtklelkrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsq esvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgecNucleic Acid Sequence Encoding the Full Length Chimeric 29B06 Heavy Chain(Mouse Heavy Chain Variable Region and Human IgG1 Constant Region)(SEQ ID NO: 159)1gaggtgcagc ttcaggagtc aggacctagc ctcgtgaaac cttctcagac tctgtccctc61acctgttctg tcactggcga ctccatcacc agtggttact ggaactggat ccggaaattc121ccagggaata aacttgagta catggggtac ataagctaca gtggtaaaac ttactacaat181ccatctctca aaagtcgaat ctccatcact cgagacacat ccaagaacca ttactacctg241cagttgattt ctgtgactgc tgaggacaca gccacatatt actgtgcaag gtctaagtac301gactatgcta tggactactg gggtcaagga acctcagtca ccgtctcctc agcctcaaca361aaaggaccaa gtgtgttccc actcgcccct agcagcaaga gtacatccgg gggcactgca421gcactcggct gcctcgtcaa ggattatttt ccagagccag taaccgtgag ctggaacagt481ggagcactca cttctggtgt ccatactttt cctgctgtcc tgcaaagctc tggcctgtac541tcactcagct ccgtcgtgac cgtgccatct tcatctctgg gcactcagac ctacatctgt601aatgtaaacc acaagcctag caatactaag gtcgataagc gggtggaacc caagagctgc661gacaagactc acacttgtcc cccatgccct gcccctgaac ttctgggcgg tcccagcgtc721tttttgttcc caccaaagcc taaagatact ctgatgataa gtagaacacc cgaggtgaca781tgtgttgttg tagacgtttc ccacgaggac ccagaggtta agttcaactg gtacgttgat841ggagtcgaag tacataatgc taagaccaag cctagagagg agcagtataa tagtacatac901cgtgtagtca gtgttctcac agtgctgcac caagactggc tcaacggcaa agaatacaaa961tgcaaagtgt ccaacaaagc actcccagcc cctatcgaga agactattag taaggcaaag1021gggcagcctc gtgaaccaca ggtgtacact ctgccaccca gtagagagga aatgacaaag1081aaccaagtct cattgacctg cctggtgaaa ggcttctacc ccagcgacat cgccgttgag1141tgggagagta acggtcagcc tgagaacaat tacaagacaa cccccccagt gctggatagt1201gacgggtctt tctttctgta cagtaagctg actgtggaca agtcccgctg gcagcagggt1261aacgtcttca gctgttccgt gatgcacgag gcattgcaca accactacac ccagaagtca1321ctgagcctga gcccagggaa gProtein Sequence Defining the Full Length Chimeric 29B06 Heavy Chain (MouseHeavy Chain Variable Region and Human IgG1 Constant Region)(SEQ ID NO: 160)1evqlqesgps lvkpsqtlsl tcsvtgdsit sgywnwirkf pgnkleymgy isysgktyyn61pslksrisit rdtsknhyyl qlisvtaedt atyycarsky dyamdywgqg tsvtvssast121kgpsvfplap sskstsggta algclvkdyf pepvtvswns galtsgvhtf pavlqssgly181slssvvtvps sslgtqtyic nvnhkpsntk vdkrvepksc dkthtcppcp apellggpsv241flfppkpkdt lmisrtpevt cvvvdvshed pevkfnwyvd gvevhnaktk preeqynsty301rvvsvltvlh qdwlngkeyk ckvsnkalpa piektiskak gqprepqvyt lppsreemtk361nqvsltclvk gfypsdiave wesngqpenn ykttppvlds dgsfflyskl tvdksrwqqg421nvfscsvmhe alhnhytqks lslspgkNucleic Acid Sequence Encoding the Full Length Chimeric 29B06 Light Chain(Mouse Kappa Chain Variable Region and Human Kappa Constant Region)(SEQ ID NO: 161)1gacattgtgc tgacccaatc tccagcttct ttggctgtgt ctctaggaca gagggccacc61atctcctgca gagccagcga aattgttgat aattttggca ttagttttat gaactggttc121caacagaaac caggacagcc acccaaactc ctcatctatg ctgcatccaa ccaaggatcc181ggggtccctg ccaggtttag tggcagtggg tctgggacag acttcagcct caacatccat241cctgtggagg aggatgatac tgcaatgtat ttctgtcagc aaagtaagga ggttcctccg301acgttcggtg gaggcaccaa gctggaaatc aaacgcacag tcgccgctcc ctccgtgttc361atctttccac caagtgatga gcaactgaag tctggtactg cttcagtcgt gtgtctgctg421aacaatttct accctcgaga agccaaagtc caatggaagg tagacaacgc actgcagtcc481ggcaatagcc aagaatcagt taccgaacag gattcaaagg acagtacata ttccctgagc541agcactctga ccctgtcaaa ggccgattac gagaaacaca aggtctatgc ttgcgaagtg601acacatcagg gactgtccag cccagtgaca aaatctttta accgtgggga gtgtProtein Sequence Defining the Full Length Chimeric 29B06 Light Chain (MouseKappa Chain Variable Region and Human Kappa Constant Region)(SEQ ID NO: 162)1divltqspas layslgqrat iscraseivd nfgisfmnwf qqkpgqppkl liyaasnqgs61gvparfsgsg sgtdfslnih pveeddtamy fcqqskevpp tfgggtklei krtvaapsvf121ifppsdeqlk sgtasvvcll nnfypreakv qwkvdnalqs gnsqesvteq dskdstysls181stltlskady ekhkvyacev thqglsspvt ksfnrgecNucleic Acid Sequence Encoding the Full Length Humanized Sh07F01 Hv3-48Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region)(SEQ ID NO: 163)1gaggttcagc tggtagaatc cggaggaggg ttggtccaac ctggtggatc actcagactt61tcatgcgccg ccagcggctt tgacttctca cgacattgga tgagctgggt ccggcaggct121ccaggcaagg gcctcgagtg ggttagcgag atcaatccag acagcagaac cattaactat181acacccagtc tgaaggagcg gttcaccata agccgtgata atgccaagaa ctccctgtac241ttgcagatga actccttgcg cgctgaagat acagctgtgt actattgtgc aaggcgcgtg301cgaatccact attacggggc aatggattct tggggccagg gtactaccgt gactgtgagt361tctgcctcaa caaaaggacc aagtgtgttc ccactcgccc ctagcagcaa gagtacatcc421gggggcactg cagcactcgg ctgcctcgtc aaggattatt ttccagagcc agtaaccgtg481agctggaaca gtggagcact cacttctggt gtccatactt ttcctgctgt cctgcaaagc541tctggcctgt actcactcag ctccgtcgtg accgtgccat cttcatctct gggcactcag601acctacatct gtaatgtaaa ccacaagcct agcaatacta aggtcgataa gcgggtggaa661cccaagagct gcgacaagac tcacacttgt cccccatgcc ctgcccctga acttctgggc721ggtcccagcg tctttttgtt cccaccaaag cctaaagata ctctgatgat aagtagaaca781cccgaggtga catgtgttgt tgtagacgtt tcccacgagg acccagaggt taagttcaac841tggtacgttg atggagtcga agtacataat gctaagacca agcctagaga ggagcagtat901aatagtacat accgtgtagt cagtgttctc acagtgctgc accaagactg gctcaacggc961aaagaataca aatgcaaagt gtccaacaaa gcactcccag cccctatcga gaagactatt1021agtaaggcaa aggggcagcc tcgtgaacca caggtgtaca ctctgccacc cagtagagag1081gaaatgacaa agaaccaagt ctcattgacc tgcctggtga aaggcttcta ccccagcgac1141atcgccgttg agtgggagag taacggtcag cctgagaaca attacaagac aaccccccca1201gtgctggata gtgacgggtc tttctttctg tacagtaagc tgactgtgga caagtcccgc1261tggcagcagg gtaacgtctt cagctgttcc gtgatgcacg aggcattgca caaccactac1321acccagaagt cactgagcct gagcccaggg aagProtein Sequence Defining the Full Length Humanized Sh07F01 Hv3-48 HeavyChain(Humanized Heavy Chain Variable Region and Human IgG1 Constant Region)(SEQ ID NO: 164)1evqlvesggg lvqpggslrl scaasgfdfs rhwmswvrqa pgkglewvse inpdsrtiny61tpslkerfti srdnaknsly lqmnslraed tavyycarrv rihyygamds wgqgttvtvs121sastkgpsvf plapssksts ggtaalgclv kdyfpepvtv swnsgaltsg vhtfpavlqs181sglyslssvv tvpssslgtq tyicnvnhkp sntkvdkrve pkscdkthtc ppcpapellg241gpsvflfppk pkdtlmisrt pevtcvvvdv shedpevkfn wyvdgvevhn aktkpreeqy301nstyrvvsvl tvlhqdwlng keykckvsnk alpapiekti skakgqprep qvytlppsre361emtknqvslt clvkgfypsd iavewesngq pennykttpp vldsdgsffl yskltvdksr421wqqgnvfscs vmhealhnhy tqkslslspg kNucleic Acid Sequence Encoding the Full Length Humanized Sh07F01 Hv3-48 D28TT60A L63V E65G Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1Constant Region)(SEQ ID NO: 165)1gaggttcagc tggtagaatc cggaggaggg ttggtccaac ctggtggatc actcagactt61tcatgcgccg ccagcggctt taccttctca cgacattgga tgagctgggt ccggcaggct121ccaggcaagg gcctcgagtg ggttagcgag atcaatccag acagcagaac cattaactat181gcccccagtg tgaagggccg gttcaccata agccgtgata atgccaagaa ctccctgtac241ttgcagatga actccttgcg cgctgaagat acagctgtgt actattgtgc aaggcgcgtg301cgaatccact attacggggc aatggattct tggggccagg gtactaccgt gactgtgagt361tctgcctcaa caaaaggacc aagtgtgttc ccactcgccc ctagcagcaa gagtacatcc421gggggcactg cagcactcgg ctgcctcgtc aaggattatt ttccagagcc agtaaccgtg481agctggaaca gtggagcact cacttctggt gtccatactt ttcctgctgt cctgcaaagc541tctggcctgt actcactcag ctccgtcgtg accgtgccat cttcatctct gggcactcag601acctacatct gtaatgtaaa ccacaagcct agcaatacta aggtcgataa gcgggtggaa661cccaagagct gcgacaagac tcacacttgt cccccatgcc ctgcccctga acttctgggc721ggtcccagcg tctttttgtt cccaccaaag cctaaagata ctctgatgat aagtagaaca781cccgaggtga catgtgttgt tgtagacgtt tcccacgagg acccagaggt taagttcaac841tggtacgttg atggagtcga agtacataat gctaagacca agcctagaga ggagcagtat901aatagtacat accgtgtagt cagtgttctc acagtgctgc accaagactg gctcaacggc961aaagaataca aatgcaaagt gtccaacaaa gcactcccag cccctatcga gaagactatt1021agtaaggcaa aggggcagcc tcgtgaacca caggtgtaca ctctgccacc cagtagagag1081gaaatgacaa agaaccaagt ctcattgacc tgcctggtga aaggcttcta ccccagcgac1141atcgccgttg agtgggagag taacggtcag cctgagaaca attacaagac aaccccccca1201gtgctggata gtgacgggtc tttctttctg tacagtaagc tgactgtgga caagtcccgc1261tggcagcagg gtaacgtctt cagctgttcc gtgatgcacg aggcattgca caaccactac1321acccagaagt cactgagcct gagcccaggg aagProtein Sequence Defining the Full Length Humanized Sh07F01 Hv3-48 D28T T60AL63V E65G Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1Constant Region)(SEQ ID NO: 166)1evqlvesggg lvqpggslrl scaasgftfs rhwmswvrqa pgkglewvse inpdsrtiny61apsvkgrfti srdnaknsly lqmnslraed tavyycarrv rihyygamds wgqgttvtvs121sastkgpsvf plapssksts ggtaalgclv kdyfpepvtv swnsgaltsg vhtfpavlqs181sglyslssvv tvpssslgtq tyicnvnhkp sntkvdkrve pkscdkthtc ppcpapellg241gpsvflfppk pkdtlmisrt pevtcvvvdv shedpevkfn wyvdgvevhn aktkpreeqy301nstyrvvsvl tvlhqdwlng keykckvsnk alpapiekti skakgqprep qvytlppsre361emtknqvslt clvkgfypsd iavewesngq pennykttpp vldsdgsffl yskltvdksr421wqqgnvfscs vmhealhnhy tqkslslspg kNucleic Acid Sequence Encoding the Full Length Humanized HE L 07F01 Kv1-9Light Chain (Humanized Kappa Chain Variable Region and Human Constant Region)(SEQ ID NO: 167)1gatatccagt tgactcagtc tcagtccttt gtgagtacat cagtgggcga cagggtcacc61gtgacctgcc gagcatcaca gaacgttgga agctctcttg tctggtatca gcaaaagcct121gggaagagcc ccaaaaccct catctattct gcttcctttc tgtactccgg cgtaccaagt181agattctctg gtagcggatc cgggacagag ttcactctca caattagcag tgtgcagcct241gaggatttcg ccgactactt ctgtcagcaa tacaataact atcccctgac ttttggtggc301ggcaccaaag tggaaatcaa gcgcacagtt gctgccccca gcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtat gcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcac ttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttatt cactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcct gcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gtProtein Sequence Defining the Full Length Humanized HE L 07F01 Kv1-9 LightChain (Humanized Kappa Chain Variable Region and Human Constant Region)(SEQ ID NO: 168)1diqltqsqsf vstsvgdrvt vtcrasqnvg sslvwyqqkp gkspktliys asflysgvps61rfsgsgsgte ftltissvqp edfadyfcqq ynnypltfgg gtkveikrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsq esvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgecNucleic Acid Sequence Encoding the Full Length Humanized sh07F01 Kv1-9 F1Light Chain (Humanized Kappa Chain Variable Region and Human Constant Region)(SEQ ID NO: 169)1gacattcagc tgactcagtc gccgtcgttt ttgtcggcgt ccgtgggtga cagagtgact61atcacatgtc gcgcttcgca aaacgtcgga tcatcgcttg tgtggtatca gcagaaaccc121ggtaaagccc ctaagaccct catctattca gcgtcatttc tgtatagcgg ggtcccctca181cggttcagcg gatccggctc cgggaccgag ttcacactca ctatttcgag cttgcagccg241gaagattttg caacgtacta ctgccagcaa tacaataact acccactcac gttcggaggg301ggaacgaagg tagagatcaa gcgcacagtt gctgccccca gcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtat gcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcac ttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttatt cactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcct gcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gtProtein Sequence Defining the Full Length Humanized sh07F01 Kv1-9 F1 LightChain (Humanized Kappa Chain Variable Region and Human Constant Region)(SEQ ID NO: 170)1diqltqspsf lsasvgdrvt itcrasqnvg sslvwyqqkp gkapktliys asflysgvps61rfsgsgsgte ftltisslqp edfatyycqq ynnypltfgg gtkveikrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsq esvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgecNucleic Acid Sequence Encoding the Full Length Humanized Sh29B06 Hv4-59Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region)(SEQ ID NO: 171)1caagttcagc tgcaagaatc cggaccagga ttggtcaaac cttcagagac actcagcctg61acttgcaccg tgagcggtgg cagcatatcc tccggttatt ggaactggat ccggcagcca121ccaggcaagg gcctcgagtg gattggctac atcagctata gcgggaaaac ctattacaac181cccagtctga agagccgagt gaccataagc gtcgatacaa gtaagaacca gttctccctg241aagctctcat ccgtgaccgc cgctgataca gctgtgtact attgtgcaag gtcaaagtat301gactacgcaa tggactattg gggccagggt actctggtga ctgtgagttc tgcctcaaca361aaaggaccaa gtgtgttccc actcgcccct agcagcaaga gtacatccgg gggcactgca421gcactcggct gcctcgtcaa ggattatttt ccagagccag taaccgtgag ctggaacagt481ggagcactca cttctggtgt ccatactttt cctgctgtcc tgcaaagctc tggcctgtac541tcactcagct ccgtcgtgac cgtgccatct tcatctctgg gcactcagac ctacatctgt601aatgtaaacc acaagcctag caatactaag gtcgataagc gggtggaacc caagagctgc661gacaagactc acacttgtcc cccatgccct gcccctgaac ttctgggcgg tcccagcgtc721tttttgttcc caccaaagcc taaagatact ctgatgataa gtagaacacc cgaggtgaca781tgtgttgttg tagacgtttc ccacgaggac ccagaggtta agttcaactg gtacgttgat841ggagtcgaag tacataatgc taagaccaag cctagagagg agcagtataa tagtacatac901cgtgtagtca gtgttctcac agtgctgcac caagactggc tcaacggcaa agaatacaaa961tgcaaagtgt ccaacaaagc actcccagcc cctatcgaga agactattag taaggcaaag1021gggcagcctc gtgaaccaca ggtgtacact ctgccaccca gtagagagga aatgacaaag1081aaccaagtct cattgacctg cctggtgaaa ggcttctacc ccagcgacat cgccgttgag1141tgggagagta acggtcagcc tgagaacaat tacaagacaa cccccccagt gctggatagt1201gacgggtctt tctttctgta cagtaagctg actgtggaca agtcccgctg gcagcagggt1261aacgtcttca gctgttccgt gatgcacgag gcattgcaca accactacac ccagaagtca1321ctgagcctga gcccagggaa gProtein Sequence Defining the Full Length Humanized Sh29B06 Hv4-59 HeavyChain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region)(SEQ ID NO: 172)1qvqlqesgpg lvkpsetlsl tctvsggsis sgywnwirqp pgkglewigy isysgktyyn61pslksrvtis vdtsknqfsl klssvtaadt avyycarsky dyamdywgqg tlvtvssast121kgpsvfplap sskstsggta algclvkdyf pepvtvswns galtsgvhtf pavlqssgly181slssvvtvps sslgtqtyic nvnhkpsntk vdkrvepksc dkthtcppcp apellggpsv241flfppkpkdt lmisrtpevt cvvvdvshed pevkfnwyvd gvevhnaktk preeqynsty301rvvsvltvlh qdwlngkeyk ckvsnkalpa piektiskak gqprepqvyt lppsreemtk361nqvsltclvk gfypsdiave wesngqpenn ykttppvlds dgsfflyskl tvdksrwqqg421nvfscsvmhe alhnhytqks lslspgkNucleic Acid Sequence Encoding the Full Length Humanized Hu29B06 Hv4-59Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region)(SEQ ID NO: 173)1caagttcagc tgcaagaatc cggaccagga ttggtcaaac ccagcgaaac actctctctt61acatgcaccg tgagcggcga ctctatcacc tcagggtatt ggaattggat tcggaaaccc121ccaggcaaga agctcgagta catgggttac atcagttaca gcgggaaaac ctactataac181cccagtctga agagcagaat caccataagc cgtgatacct ctaagaacca gtactccctg241aagctgagtt ccgtaacagc agctgataca gctgtgtact attgtgcaag gagtaagtat301gactacgcaa tggactattg gggccagggt actcttgtga ctgtgagttc tgcctcaaca361aaaggaccaa gtgtgttccc actcgcccct agcagcaaga gtacatccgg gggcactgca421gcactcggct gcctcgtcaa ggattatttt ccagagccag taaccgtgag ctggaacagt481ggagcactca cttctggtgt ccatactttt cctgctgtcc tgcaaagctc tggcctgtac541tcactcagct ccgtcgtgac cgtgccatct tcatctctgg gcactcagac ctacatctgt601aatgtaaacc acaagcctag caatactaag gtcgataagc gggtggaacc caagagctgc661gacaagactc acacttgtcc cccatgccct gcccctgaac ttctgggcgg tcccagcgtc721tttttgttcc caccaaagcc taaagatact ctgatgataa gtagaacacc cgaggtgaca781tgtgttgttg tagacgtttc ccacgaggac ccagaggtta agttcaactg gtacgttgat841ggagtcgaag tacataatgc taagaccaag cctagagagg agcagtataa tagtacatac901cgtgtagtca gtgttctcac agtgctgcac caagactggc tcaacggcaa agaatacaaa961tgcaaagtgt ccaacaaagc actcccagcc cctatcgaga agactattag taaggcaaag1021gggcagcctc gtgaaccaca ggtgtacact ctgccaccca gtagagagga aatgacaaag1081aaccaagtct cattgacctg cctggtgaaa ggcttctacc ccagcgacat cgccgttgag1141tgggagagta acggtcagcc tgagaacaat tacaagacaa cccccccagt gctggatagt1201gacgggtctt tctttctgta cagtaagctg actgtggaca agtcccgctg gcagcagggt1261aacgtcttca gctgttccgt gatgcacgag gcattgcaca accactacac ccagaagtca1321ctgagcctga gcccagggaa gProtein Sequence Defining the Full Length Humanized Hu29B06 Hv4-59 HeavyChain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region)(SEQ ID NO: 174)1qvqlgesgpg lvkpsetlsl tctvsgdsit sgywnwirkp pgkkleymgy isysgktyyn61pslksritis rdtsknqysl klssvtaadt avyycarsky dyamdywgqg tlvtvssast121kgpsvfplap sskstsggta algclvkdyf pepvtvswns galtsgvhtf pavlqssgly181slssvvtvps sslgtqtyic nvnhkpsntk vdkrvepksc dkthtcppcp apellggpsv241flfppkpkdt lmisrtpevt cvvvdvshed pevkfnwyvd gvevhnaktk preeqynsty301rvvsvltvlh qdwlngkeyk ckvsnkalpa piektiskak gqprepqvyt lppsreemtk361nqvsltclvk gfypsdiave wesngqpenn ykttppvlds dgsfflyskl tvdksrwqqg421nvfscsvmhe alhnhytqks lslspgkNucleic Acid Sequence Encoding the Full Length Humanized Hu29B06 Hv4-59D27G T30S M48I I67V Y78F Heavy Chain (Humanized Heavy Chain Variable Region andHuman IgG1 Constant Region)(SEQ ID NO: 175)1caagttcagc tgcaagaatc cggaccagga ttggtcaaac cttcagagac actcagcctg61acttgcaccg tgagcggtgg cagcatatcc tccggttatt ggaactggat ccggaagcca121ccaggcaaga agctcgagta cattggctac atcagctata gcgggaaaac ctattacaac181cccagtctga agagccgagt gaccataagc agggatacaa gtaagaacca gttctccctg241aagctctcat ccgtgaccgc cgctgataca gctgtgtact attgtgcaag gtcaaagtat301gactacgcaa tggactattg gggccagggt actctggtga ctgtgagttc tgcctcaaca361aaaggaccaa gtgtgttccc actcgcccct agcagcaaga gtacatccgg gggcactgca421gcactcggct gcctcgtcaa ggattatttt ccagagccag taaccgtgag ctggaacagt481ggagcactca cttctggtgt ccatactttt cctgctgtcc tgcaaagctc tggcctgtac541tcactcagct ccgtcgtgac cgtgccatct tcatctctgg gcactcagac ctacatctgt601aatgtaaacc acaagcctag caatactaag gtcgataagc gggtggaacc caagagctgc661gacaagactc acacttgtcc cccatgccct gcccctgaac ttctgggcgg tcccagcgtc721tttttgttcc caccaaagcc taaagatact ctgatgataa gtagaacacc cgaggtgaca781tgtgttgttg tagacgtttc ccacgaggac ccagaggtta agttcaactg gtacgttgat841ggagtcgaag tacataatgc taagaccaag cctagagagg agcagtataa tagtacatac901cgtgtagtca gtgttctcac agtgctgcac caagactggc tcaacggcaa agaatacaaa961tgcaaagtgt ccaacaaagc actcccagcc cctatcgaga agactattag taaggcaaag1021gggcagcctc gtgaaccaca ggtgtacact ctgccaccca gtagagagga aatgacaaag1081aaccaagtct cattgacctg cctggtgaaa ggcttctacc ccagcgacat cgccgttgag1141tgggagagta acggtcagcc tgagaacaat tacaagacaa cccccccagt gctggatagt1201gacgggtctt tctttctgta cagtaagctg actgtggaca agtcccgctg gcagcagggt1261aacgtcttca gctgttccgt gatgcacgag gcattgcaca accactacac ccagaagtca1321ctgagcctga gcccagggaa gProtein Sequence Defining the Full Length Humanized Hu29B06 Hv4-59 D27GT30S M48I I67V Y78F Heavy Chain (Humanized Heavy Chain Variable Region and HumanIgG1 Constant Region)(SEQ ID NO: 176)1qvglgesgpg lvkpsetlsl tctvsggsis sgywnwirkp pgkkleyigy isysgktyyn61pslksrvtis rdtsknqfsl klssvtaadt avyycarsky dyamdywgqg tlvtvssast121kgpsvfplap sskstsggta algclvkdyf pepvtvswns galtsgvhtf pavlqssgly181slssvvtvps sslgtqtyic nvnhkpsntk vdkrvepksc dkthtcppcp apellggpsv241flfppkpkdt lmisrtpevt cvvvdvshed pevkfnwyvd gvevhnaktk preeqynsty301rvvsvltvlh qdwlngkeyk ckvsnkalpa piektiskak gqprepqvyt lppsreemtk361nqvsltclvk gfypsdiave wesnggpenn ykttppvlds dgsfflyskl tvdksrwqqg421nvfscsvmhe alhnhytqks lslspgkNucleic Acid Sequence Encoding the Full Length Humanized Sh29B06 Kv2-28 LightChain (Humanized Kappa Chain Variable Region and Human Constant Region)(SEQ ID NO: 177)1gatatcgtta tgacccagag cccacttagt ttgcctgtta ctcctggcga gcctgccagt61atttcttgcc gtgctagcga aatcgtggat aactttggta tatcattcat gaattggtat121ctccaaaaac ctggccaaag cccccagctc cttatctacg ccgctagcaa ccaggggtcc181ggggtacctg atagattttc aggcagcggc tctggaaccg acttcacact gaagatttcc241cgggtggagg ccgaggacgt gggcgtgtac tattgtcaac agtccaagga agtccctccc301actttcggcg gtgggacaaa ggttgagatt aagcgcacag ttgctgcccc cagcgtgttc361attttcccac ctagcgatga gcagctgaaa agcggtactg cctctgtcgt atgcttgctc421aacaactttt acccacgtga ggctaaggtg cagtggaaag tggataatgc acttcaatct481ggaaacagtc aagagtccgt gacagaacag gacagcaaag actcaactta ttcactctct541tccaccctga ctctgtccaa ggcagactat gaaaaacaca aggtatacgc ctgcgaggtt601acacaccagg gtttgtctag tcctgtcacc aagtccttca ataggggcga atgtProtein Sequence Defining the Full Length Humanized Sh29B06 Kv2-28 Light Chain(Humanized Kappa Chain Variable Region and Human Constant Region)(SEQ ID NO: 178)1divmtqspls lpvtpgepas iscraseivd nfgisfmnwy lqkpggspql liyaasnqgs61gvpdrfsgsg sgtdftlkis rveaedvgvy ycqqskevpp tfgggtkvei krtvaapsvf121ifppsdeqlk sgtasvvcll nnfypreakv qwkvdnalqs gnsqesvteq dskdstysls181stltlskady ekhkvyacev thqglsspvt ksfnrgec For convenience, Table 18 provides a concordance chart showing the SEQ ID NO. of each sequence discussed in this Example. TABLE 18SEQ ID NO.Nucleic Acid or Protein150Human IgG1 constant-nucleic acid151Human IgG1 constant-protein152Human Kappa constant (used for chimeric antibodies)-nucleic acid153Human Kappa constant (used for humanized antibodies)-nucleic acid154Human Kappa constant (used for chimeric and humanized antibodies)-protein155Chimeric 07F01 C102S Mouse Heavy Chain Variable + Human IgG1 constant-nucleic acid156Chimeric 07F01 C102S Mouse Heavy Chain Variable + Human IgG1 constant-protein157Chimeric 07F01 Mouse Light Chain Variable + Human Kappa constant-nucleic acid158Chimeric 07F01 Mouse Light Chain Variable + Human Kappa constant-protein159Chimeric 29B06 Mouse Heavy Chain Variable + Human IgG1 constant-nucleic acid160Chimeric 29B06 Mouse Heavy Chain Variable + Human IgG1 constant-protein161Chimeric 29B06 Mouse Light Chain Variable + Human Kappa constant-nucleic acid162Chimeric 29B06 Mouse Light Chain Variable + Human Kappa constant-protein163Humanized Sh07F01 Hv3-48 Heavy Human Variable + Human IgG1 constant-nucleic acid164Humanized Sh07F01 Hv3-48 Heavy Human Variable + Human IgG1 constant-protein165Humanized Sh07F01 Hv3-48 D28T T60A L63V E65G Heavy Human Variable +Human IgG1 constant-nucleic acid166Humanized Sh07F01 Hv3-48 D28T T60A L63V E65G Heavy Human Variable +Human IgG1 constant-protein167Humanized HE L 07F01 Kv1-9 Human Variable + Human Kappa constant-nucleicacid168Humanized HE L 07F01 Kv1-9 Human Variable + Human Kappa constant-protein169Humanized sh07F01 Kv1-9 F1 Human Variable + Human Kappa constant-nucleicacid170Humanized sh07F01 Kv1-9 F1 Human Variable + Human Kappa constant-protein171Humanized Sh29B06 Hv4-59 Heavy Human Variable + Human IgG1 constant-nucleic acid172Humanized Sh29B06 Hv4-59 Heavy Human Variable + Human IgG1 constant-protein173Humanized Hu29B06 Hv4-59 Heavy Human Variable + Human IgG1 constant-nucleic acid174Humanized Hu29B06 Hv4-59 Heavy Human Variable + Human IgG1 constant-protein175Humanized Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F Heavy Human Variable +Human IgG1 constant-nucleic acid176Humanized Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F Heavy Human Variable +Human IgG1 constant-protein177Humanized Sh29B06 Kv2-28 Human Variable + Human Kappa constant-nucleicacid178Humanized Sh29B06 Kv2-28 Human Variable + Human Kappa constant-protein Table 19 below shows antibodies containing chimeric immunoglobulin heavy and light chains and each of the possible combinations of the full-length chimeric or humanized immunoglobulin heavy and light chains. TABLE 19AntibodyNameLight ChainHeavy ChainSh07F01-2Chimeric 07F01 KappaChimeric 07F01 C102S(SEQ ID NO: 158)Heavy IgG1(SEQ ID NO: 156)Sh07F01-43HE L 07F01 Kv1-9Sh07F01 Hv3-48 IgG1Kappa(SEQ ID NO: 164)(SEQ ID NO: 168)Sh07F01-62HE L 07F01 Kv1-9Sh07F01 Hv3-48 D28TKappaT60A L63V E65G IgG1(SEQ ID NO: 168)(SEQ ID NO: 166)Sh07F01-69Sh07F01 Kv1-9 F1Sh07F01 Hv3-48 IgG1Kappa(SEQ ID NO: 164)(SEQ ID NO: 170)Sh07F01-83Sh07F01 Kv1-9 F1Sh07F01 Hv3-48 D28TKappaT60A L63V E65G IgG1(SEQ ID NO: 170)(SEQ ID NO: 166)Sh07F01-99Chimeric 07F01 KappaSh07F01 Hv3-48 IgG1(SEQ ID NO: 158)(SEQ ID NO: 164)Sh07F01-100Chimeric 07F01 KappaSh07F01 Hv3-48 D28T(SEQ ID NO: 158)T60A L63V E65G IgG1(SEQ ID NO: 166)Sh07F01-101HE L 07F01 Kv1-9Chimeric 07F01 C102SKappaHeavy IgG1(SEQ ID NO: 168)(SEQ ID NO: 156)Sh07F01-102Sh07F01 Kv1-9 F1Chimeric 07F01 C102SKappaHeavy IgG1(SEQ ID NO: 170)(SEQ ID NO: 156)Sh29B06-1Chimeric 29B06 KappaChimeric 29B06 Heavy IgG1(SEQ ID NO: 162)(SEQ ID NO: 160)Sh29B06-2Chimeric 29B06 KappaHu29B06 Hv4-59 IgG1(SEQ ID NO: 162)(SEQ ID NO: 174)Sh29B06-4Chimeric 29B06 KappaSh29B06 Hv4-59 IgG1(SEQ ID NO: 162)(SEQ ID NO: 172)Sh29B06-9Sh29B06 Kv2-28 KappaChimeric 29B06 Heavy IgG1(SEQ ID NO: 178)(SEQ ID NO: 160)Sh29B06-23Sh29B06 Kv2-28 KappaHu29B06 Hv4-59 IgG1(SEQ ID NO: 178)(SEQ ID NO: 174)Sh29B06-25Sh29B06 Kv2-28 KappaSh29B06 Hv4-59 IgG1(SEQ ID NO: 178)(SEQ ID NO: 172)Sh29B06-78Sh29B06 Kv2-28 KappaHu29B06 Hv4-59 D27G(SEQ ID NO: 178)T30S M48I I67V Y78F IgG1(SEQ ID NO: 176)Sh29B06-84Chimeric 29B06 KappaHu29B06 Hv4-59 D27G(SEQ ID NO: 162)T30S M48I I67V Y78F IgG1(SEQ ID NO: 176) The antibody constructs containing the full length chimeric heavy and light chains are designated below: Chimeric 07F01 C102S=Full Length Chimeric 07F01 C102S Heavy Chain (Mouse Variable Region with C102S mutation and Human IgG1 Constant Region) (SEQ ID NO: 156) plus Full Length Chimeric 07F01 Light Chain (Mouse Variable Region and Human Kappa Constant Region) (SEQ ID NO: 158)Chimeric 29B06=Full Length Chimeric 29B06 Heavy Chain (Mouse Variable Region and Human IgG1 Constant Region) (SEQ ID NO: 160) plus Full Length Chimeric 29B06 Light Chain (Mouse Variable Region and Human Kappa Constant Region) (SEQ ID NO: 162) Two of the possible antibody constructs containing the full length immunoglobulin heavy and light chains containing humanized variable regions are designated below: Sh07F01-62=Humanized Sh07F01 Hv3-48 D28T T60A L63V E65G Heavy Chain Variable Region and Human IgG1 Constant Region (SEQ ID NO: 166) plus HE L 07F01 Kv1-9 Light Chain Variable Region and Human Kappa Constant Region (SEQ ID NO: 168)Sh29B06-78=Humanized Hu29B06 Hv4-59 D27G T30S M48I I67V Y78F Heavy Chain Variable Region and Human IgG1 Constant Region (SEQ ID NO: 176) plus Sh29B06 Kv2-28 Light Chain Variable Region and Human Kappa Constant Region (SEQ ID NO: 178) B. Binding Affinities of Humanized and Chimeric Anti-RON Monoclonal Antibodies The binding affinities and kinetics of interaction of monoclonal antibodies produced in Example 14 against recombinant human RON SEMA and PSI domains (rhRON SEMA+PSI) (R&D Systems, Inc., Minneapolis, Minn.) were measured by surface plasmon resonance using a Biacore T100 (Biacore (GE Healthcare), Piscataway, N.J.) instrument. Goat anti-human IgG Fc (Jackson ImmunoResearch, Catalog No. 109-005-098) was immobilized on carboxymethylated dextran CM4 sensor chips (Biacore) by amine coupling (Biacore) using a standard coupling protocol according to the vendor's instructions. The analyses were performed at 37° C. using PBS (Invitrogen) containing 0.05% surfactant P20 (Biacore) as running buffer. The antibodies were captured in individual flow cells at a flow rate of 60 μl/minute. Injection time was varied for each antibody to yield an R max between 30 and 60 RU. Buffer or rhRON SEMA+PSI diluted in running buffer was injected sequentially over a reference surface (no antibody captured) and the active surface (antibody to be tested) for 300 seconds at 60 μl/minute. The dissociation phase was monitored for up to 1200 seconds. The surface was then regenerated with two 60 second injections of Glycine pH 2.25 (made from Glycine pH 2.0 (Biacore) and pH 2.5 (Biacore)) at 60 μl/minute. For the initial screening, only one or two concentrations of rhRON SEMA+PSI were tested, typically 10.0 and 2.5 nM (results are summarized in Table 20). Kinetic parameters were determined using the kinetic function of the BIAevaluation software (Biacore) with double reference subtraction. Kinetic parameters for each antibody, k a (association rate constant), k d (dissociation rate constant) and K D (equilibrium dissociation constant) were determined. Certain monoclonal antibodies were screened using cell culture media supernatant containing secreted antibody, and kinetic values of the monoclonal antibodies on rhRON SEMA+PSI at 37° C. are summarized in Table 20. TABLE 20Antibodyka (1/Ms)kd (1/s)KD (M)nSh07F01-22.0E+067.3E−043.8E−103Sh07F01-623.9E+061.4E−033.6E−102Sh07F01-692.3E+061.2E−035.6E−102Sh07F01-762.3E+061.3E−035.7E−102Sh07F01-832.6E+061.4E−035.4E−102Sh29B06-16.7E+057.6E−041.1E−093Sh29B06-98.7E+052.2E−042.6E−101Sh29B06-237.8E+054.8E−046.4E−104Sh29B06-25No Binding The results in Table 20 demonstrate that the chimeric and each of the humanized antibodies, except Sh29B06-25, have fast association rates (k a ), very slow disassociation rates (k d ) and very high affinities (K D ). In particular, the antibodies have affinities ranging from about 260 pM to about 1.1 nM. No binding was observed for Sh29B06-25. Because Sh29B06-25 does not bind rhRON SEMA+PSI and Sh29B06-23 does, one or more of the back mutations present in the heavy chain of Sh29B06-23 appear to be required for binding with high affinity. The binding affinities and kinetics of certain purified monoclonal antibodies were also determined. To further characterize certain antibodies, the surface plasmon resonance experiments described above were conducted using concentrations of rhRON SEMA+PSI between 0.3125 nM and 10.0 nM (a 2-fold serial dilution). The kinetic values of certain purified monoclonal antibodies (i.e., Sh07F01-62 and Sh29B06-78) on rhRON SEMA+PSI at 25° C. and 37° C. are summarized in Table 21. TABLE 21Antibody Binding to rhRON SEMA + PSIMeasurements at 25° C.Measurements at 37° C.Antibodyka (1/Ms)kd (1/s)KD (M)nka (1/Ms)kd (1/s)KD (M)nSh07F01-21.2E+069.8E−058.2E−1191.7E+065.3E−043.1E−109Sh07F01-431.2E+061.1E−049.0E−1131.8E+065.6E−043.0E−103Sh07F01-621.8E+061.6E−048.5E−1142.8E+066.9E−042.5E−104Sh07F01-691.1E+061.4E−041.2E−1022.5E+067.8E−043.0E−102Sh07F01-769.8E+051.3E−041.3E−1022.4E+067.9E−043.3E−102Sh07F01-831.6E+061.8E−041.1E−1023.2E+067.9E−042.4E−102Sh29B06-15.3E+052.0E−043.6E−1068.2E+057.0E−048.6E−105Sh29B06-236.7E+059.5E−051.4E−1047.3E+053.3E−044.6E−105Sh29B06-787.5E+053.9E−055.2E−1171.0E+061.1E−041.1E−109 The results in Table 21 demonstrate the purified antibodies have affinities ranging from about 52 pM to 360 pM when tested at 25° C. or about 110 pM to about 860 pM when tested at 37° C. Binding to cell surface human wild-type RON and the delta 160 RON variant by antibodies 07F01, Sh07F01-62, 29B06, and Sh29B06-78 was measured at 4° C., using Fluorescence Activated Cell Sorting (FACS). PC3 cells expressing the human wild-type RON, and HT29 cells expressing the delta 160 variant, were harvested using cell dissociation buffer (Invitrogen), washed twice with FACS buffer (PBS with 0.5% BSA), and treated 10 minutes with Cyto Q Antibody diluent and FC receptor block (Innovex Biosciences, Richmond, Calif.). Purified antibodies were diluted in FACS buffer over a concentration range from 0.01 nM to 25 nM. Cells were incubated with 100 μl of antibody for one hour, washed with FACS buffer three times, and incubated for 45 minutes with goat anti-mouse PE-conjugated antibody (Jackson ImmunoResearch Laboratories, West Grove, Pa.) or donkey anti-human PE-conjugated antibody (Jackson ImmunoResearch Laboratories, West Grove, Pa.). Cells were washed three times with FACS buffer, resuspended in 300 μl of FACS buffer, and analyzed using a Beckman Coulter Cytomics FC 500 FACS instrument. All four antibodies were compared in the same experiment. Results are summarized in Table 22. TABLE 2207F01Sh07F01-6229B06Sh29B06-78Human RON - K D0.0530.0430.1360.090(nM)Human RON - K D0.036 to0.026 to0.083 to0.063 torange (nM)0.0690.0600.1900.117Delta 160 RON - K D0.1000.1180.1670.239(nM)Delta 160 RON - K D0.071 to0.045 to0.066 to0.202 torange (nM)0.1290.1910.2670.277 The results in Table 22 demonstrate that the humanized antibodies Sh07F01-62 and Sh29B06-78 retain their ability to bind both wild-type RON and the delta 160 RON variant on the cell surface with affinities equivalent to their murine antibody counterparts (i.e., 07F01 and 29B06, respectively). C. Comparison of Other Anti-RON Antibodies Three antibodies that inhibit the function of human RON were constructed and expressed using published information. One antibody, referred to as 1P3B2-BIIB Ab, was constructed based on the disclosure of Huet et al., U.S. Patent Publication No. 2009/0226442 (Biogen Idec, Inc.). Two additional antibodies, referred to as RON6 and RON8, were constructed based on the disclosure of Pereira et al., U.S. Patent Publication No. 2009/0136510 (Imclone Systems, Inc.). Kinetic parameters for the 1P3B2-BIIB Ab, RON6, and RON8 antibodies on rhRON SEMA+PSI at 25° C. and 37° C. were determined by Biacore as described above (See Section B. Binding Affinities of Humanized and Chimeric Anti-RON Monoclonal Antibodies). The kinetic values for each antibody are summarized in Table 23. TABLE 23Antibody Binding to rhRON SEMA + PSIMeasurements at 25° C.Measurements at 37° C.Antibodyka (1/Ms)kd (1/s)KD (M)nka (1/Ms)kd (1/s)KD (M)nSh29B06-786.8E+053.1E−054.8E−1169.6E+051.0E−041.1E−108Sh07F01-621.8E+061.6E−048.5E−1142.8E+066.9E−042.5E−1041P3B2-BIIB1.5E+061.2E−038.0E−1012.2E+072.6E−021.2E−091RON62.3E+062.6E−031.1E−0911.9E+101.9E−011.0E−091RON81.2E+066.8E−046.7E−1037.0E+062.5E−039.2E−103 The results in Table 23 demonstrate that the overall equilibrium dissociation constant (K D ) for Sh29B06-78 and Sh07F01-62 were smaller (i.e., higher affinity) than the K D for 1P3B2-BIIB, RON6, and RON8 at both 25° C. and 37° C. The K D of 1P3B2-BIIB, RON6, and RON8 antibodies can also be compared with other humanized 29B06 or 07F01 variants by comparing Tables 21 and 23. Therefore, the binding affinities of Sh29B06-78 and Sh07F01-62 are significantly higher than the affinities of 1P3B2-BIIB, RON6, and RON8 antibodies as disclosed herein. Example 15 Inhibition of MSP-RON Binding The chimeric and humanized antibodies produced in Example 14 were tested for inhibition of MSP binding to hRON SEMA+PSI, as measured by electrochemiluminescence (ECL) assay as described in Example 3. The antibodies (concentration range: 0.006-10 μg/mL) were incubated for 45 minutes at room temperature. The MSP-hRON binding interaction was inhibited by the chimeric and humanized antibodies listed in Table 24, which were tested in this assay. The IC 50 for the antibodies (IgG1) are shown in Table 24. TABLE 24AntibodyMean IC 50Std Dev of IC 50NSh29B06-11.731.248Sh29B06-231.241.579Sh29B06-780.410.248Sh07F01-20.911.428Sh07F01-430.220.092Sh07F01-620.320.126Sh07F01-690.280.182Sh07F01-760.380.332Sh07F01-830.330.242 The results in Table 24 demonstrate that the chimeric and humanized anti-RON antibodies listed in Table 24 (i.e., Sh29B06-1, Sh29B06-23, Sh29B06-78, Sh07F01-2, Sh07F01-43, Sh07F01-62, Sh07F01-69, Sh07F01-76, and Sh07F01-83) retain the ability to block MSP binding to hRON SEMA+PSI with high potency. Example 16 Inhibition of Downstream Signaling by Anti-RON Antibodies The chimeric and humanized anti-RON antibodies produced in Example 14 were tested for their ability to inhibit MSP-induced phosphorylation of ERK, a RON downstream signaling molecule, using the cell-based assay described in Example 3. The antibodies (concentration range: 0.006-10 μg/mL) in RPMI were added to the cells and incubated for one hour at 37° C. The IC50s of ERK phosphorylation inhibition by the chimeric and humanized anti-RON antibodies tested in this assay are shown in Table 25. TABLE 25AntibodyMean IC 50Std Dev of IC 50NSh29B06-10.100.106Sh29B06-230.110.0810Sh29B06-780.130.085Sh07F01-20.060.067Sh07F01-430.020.003Sh07F01-620.030.032Sh07F01-690.050.022Sh07F01-760.100.032Sh07F01-830.030.022 The results in Table 25 demonstrate that the chimeric and humanized anti-RON antibodies listed in Table 25 (i.e., Sh29B06-1, Sh29B06-23, Sh29B06-78, Sh07F01-2, Sh07F01-43, Sh07F01-62, Sh07F01-69, Sh07F01-76, and Sh07F01-83) inhibit MSP-induced ERK phosphorylation in T47D breast cancer cell line with high potency. Example 17 Inhibition of MSP-Dependent Cell Migration Humanized antibodies sh29B06-78 and sh07F01-62 as produced in Example 14 were tested for their ability to inhibit MSP-induced cell migration as described in Example 10. In this example, antibodies were added at a concentration of 1 μg/ml and serially diluted at a 1:5 dilution, and cells were incubated for 2 hours. Percent inhibition was determined by the following formula: 100−(anti-RON antibody treated-baseline)/(control huIgG treated-baseline)*100. Results on inhibition of MSP-induced HPAF-II cell migration by anti-RON antibodies, sh29B06-78 and sh07F01-62, are summarized in Table 26 and FIG. 16 . TABLE 26ABconcentrationsh29B06-78sh07F01-62ng/mlAVGStd DEVAVGStd DEV1000.0094.823.3498.963.79200.0090.672.3797.801.1240.0059.8512.5067.187.678.0059.712.8737.224.161.6063.9520.1538.9113.790.3242.0339.8843.275.760.0660.3711.9234.402.31 The results in Table 26 demonstrate that humanized anti-RON antibodies, sh29B06-78 and sh07F01-62, potently inhibit MSP-induced cell migration in HPAF-II pancreatic cancer cell lines. Example 18 Inhibition of MSP-Induced Cell Invasion Humanized antibodies sh29B06-78 and sh07F01-62 as produced in Example 14 were tested for their ability to inhibit MSP-induced cell invasion. HPAF-II pancreatic cancer cells were trypsinized, counted, and placed at a concentration of 50,000/well in 45 μl of 10% FBS/MEM in the upper chamber of a BD 96-well BD BIOCOAT™ MATRIGEL™ invasion FLUOROBLOK™ plate (Becton Dickinson). Antibodies were added at a concentration of 30 μg/ml and cells were incubated for 2 hours. The bottom chamber contained 10% FBS MEM (2000 and 1 nM MSP, and cells were incubated for 24 hours. The number of cells that underwent invasion through the membrane was determined by the addition of Calcien Dye at 4 μg/ml final concentration to the bottom chamber, followed by a one-hour incubation. Fluorescence intensity was measured using a WALLAC 1420 VICTOR™ instrument. Results on inhibition of MSP-induced HPAFII cell invasion by anti-RON antibodies are summarized in FIG. 17 . The results in FIG. 17 demonstrate that humanized anti-RON antibodies sh29B06-78 and sh07F01-6 potently inhibit MSP-dependent cell invasion in HPAF-II pancreatic cancer cell line. Example 19 Inhibition of Growth of NCI-H358 Lung Xenograft Tumor Model Inhibition of tumor growth by the humanized anti-RON antibodies was tested in an NCI-H358 lung xenograft model. The NCI-H358 cells (ATCC) were grown in culture at 37° C. in an atmosphere containing 5% CO 2 , using RMPI medium (Invitrogen) containing 10% FBS. Cells were inoculated subcutaneously into the flank of 8-week old female CB.17 SCID mice (Taconic Labs) with 5×10 6 cells per mouse in 50% matrigel (Becton Dickinson). Tumor measurements were taken twice weekly using vernier calipers. When tumors reached approximately 150 mm 3 , the mice were randomized into six groups of ten mice each. Each group received one of the following treatments: human IgG (huIgG) control, mu29B06, sh29B06-78, mu07F01, sh07F01-62 and RON8. Treatment was administered by intra-peritoneal injection two times per week at 10 mg/kg for seven weeks. Treatment was well-tolerated, with no significant loss in body weight. Tumor growth inhibition is expressed as percent inhibition (baseline subtracted) to the huIgG control and statistical analysis was conducted using ANOVA. Results for tumor growth inhibition on day 41 in the NCI-H358 model are shown in FIG. 18 and Table 27. TABLE 27ANOVATreatmentTGI %(compared to huIgG)mu29B0688.93P < 0.01sh29B06-7889.02P < 0.01mu07F0134.15P > 0.05sh07F01-6239.05P > 0.05RON837.99P > 0.05 Anti-RON antibody treatments resulted in tumor growth inhibition compared to huIgG control. Specifically, mu29B06 antibody treatment resulted in tumor growth inhibition of 89% (P<0.01); sh29B06-78 antibody treatment resulted in tumor growth inhibition of 89% (P<0.01); mu07F01 antibody treatment resulted in tumor growth inhibition of 34% (P>0.05); sh07F01-62 antibody treatment resulted in tumor growth inhibition of 39% (P>0.05); and RON8 antibody treatment resulted in tumor growth inhibition of 38% (P>0.05). These results demonstrate that sh29B06-78 and mu29B06 inhibit tumor growth in a NCI-H358 xenograft model (P<0.01), whereas the mu07F01, sh07F01-62, and RON8 antibodies did not inhibit tumor growth in this model (P>0.05, which is not statically significant). Example 20 RON Receptor Degradation Western blots were performed to determine total levels of RON receptor at the end of treatment. Four tumor samples from each of the treatment groups were weighed, lysed in RIPA buffer (Boston Bioproducts), 1 mM EDTA (Boston Bioproducts), 1 mM Sodium OrthoVandadate (Sigma), 1× protease inhibitor (Sigma) and 1× Phosphatase Inhibitor I and II (Sigma). The samples were homogenized using a hand-held electric homogenizer and incubated for 10 minutes on ice. Samples are spun down at 11,000 RPM for 30 minutes at 4° C. Supernatants were collected and protein concentrations were determined using Pierce BCA™ assay kit according to the manufacturers protocol. The C-20 (Santa Cruz) antibody was used to detect total RON protein. β-tubulin (Cell Signaling Technologies) was blotted as loading control. The Western blots were blocked for one hour in 5% Milk in 1×TBST (TBS-0.1% TWEEN™) (Sigma), followed by primary antibody incubation over night at 4° C. in 5% BSA 1×TBST at 1:1000 for both antibodies. Western blots were washed three times with 1×TBST, incubated with anti-rabbit HRP conjugated secondary antibody (Cell Signaling Technologies), for one hour at room temperature. Western blots were washed three times with 1×TBST and then developed using Dura Signal (Pierce). The results in FIG. 19 demonstrate RON receptor degradation in the mu29B06 and sh29B06-78 treated samples and to a lesser extent in the mu07F01 and sh07F01-62 treated samples. RON receptor degradation was not observed in the RON8 treated samples. INCORPORATION BY REFERENCE The entire disclosure of each of the patent documents and scientific articles referred to herein is incorporated by reference for all purposes. EQUIVALENTS The invention may be embodied in other specific forms without departing from the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting on the invention described herein. Scope of the invention is thus indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and the range of equivalency of the claims are intended to be embraced therein.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"}},"description_lang":["en"],"has_description":true,"has_docdb":true,"has_inpadoc":true,"has_full_text":true,"biblio_lang":"en"},"jurisdiction":"US","collections":[],"usersTags":[],"lensId":"031-965-843-234-266","publicationKey":"US_8829164_B2","displayKey":"US 8829164 B2","docAssets":{"lensId":"031-965-843-234-266","pdfUrl":"https://www.lens.org/images/patent/US/8829164/B2/US_8829164_B2.pdf","images":[{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000001.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000001.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000002.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000002.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000003.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000003.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000004.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000004.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000005.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000005.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000006.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000006.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000007.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000007.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000008.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000008.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000009.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000009.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000010.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000010.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000011.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000011.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000012.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000012.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000013.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000013.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000014.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000014.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000015.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000015.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000016.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000016.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000017.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000017.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000018.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000018.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000019.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000019.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000020.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000020.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000021.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000021.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000022.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000022.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000023.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000023.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000024.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000024.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000025.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000025.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000026.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000026.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000027.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000027.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000028.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000028.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000029.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000029.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000030.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000030.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000031.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000031.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000032.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000032.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000033.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000033.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000034.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000034.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000035.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000035.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000036.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000036.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000037.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000037.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000038.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000038.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000039.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000039.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000040.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000040.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000041.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000041.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000042.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000042.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000043.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000043.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000044.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000044.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000045.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000045.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000046.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000046.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000047.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000047.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000048.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000048.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000049.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000049.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000050.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000050.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000051.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000051.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000052.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000052.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000053.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000053.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000054.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000054.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000055.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000055.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000056.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000056.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000057.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000057.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000058.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000058.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000059.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000059.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000060.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000060.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000061.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000061.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000062.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000062.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000063.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000063.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000064.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000064.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000065.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000065.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000066.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000066.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000067.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000067.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000068.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000068.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000069.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000069.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000070.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000070.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000071.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000071.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000072.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000072.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000073.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000073.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000074.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000074.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000075.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000075.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000076.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000076.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000077.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000077.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000078.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000078.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000079.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000079.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000080.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000080.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000081.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000081.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000082.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000082.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000083.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000083.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000084.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000084.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000085.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000085.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000086.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000086.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000087.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000087.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000088.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000088.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000089.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000089.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000090.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000090.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000091.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000091.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000092.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000092.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000093.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000093.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000094.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000094.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000095.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000095.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000096.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000096.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000097.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000097.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000098.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000098.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000099.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000099.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000100.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000100.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000101.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000101.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000102.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000102.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000103.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000103.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000104.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000104.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000105.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000105.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000106.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000106.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000107.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000107.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000108.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000108.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000109.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000109.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000110.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000110.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000111.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000111.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000112.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000112.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000113.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000113.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000114.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000114.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000115.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000115.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000116.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000116.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000117.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000117.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000118.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000118.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000119.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000119.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000120.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000120.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000121.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000121.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000122.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000122.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000123.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000123.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000124.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000124.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000125.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000125.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000126.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000126.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000127.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000127.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000128.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000128.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000129.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000129.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000130.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000130.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000131.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000131.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000132.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000132.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000133.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000133.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000134.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000134.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000135.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000135.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000136.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000136.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000137.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000137.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000138.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000138.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/10pc/00000139.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/8829/8829164/image/page/full/00000139.png"}],"fallover":false},"countryName":"USA","inventorModel":{"inventors":[{"name":{"value":"WHALEN KERRY","valueNormalised":"Whalen Kerry"},"inventorship":null},{"name":{"value":"BOTTEGA STEVE","valueNormalised":"Bottega Steve"},"inventorship":null},{"name":{"value":"BOUDROW ANDREA","valueNormalised":"Boudrow Andrea"},"inventorship":null},{"name":{"value":"BREAULT LYNE","valueNormalised":"Breault Lyne"},"inventorship":null},{"name":{"value":"CHEN TING","valueNormalised":"Chen Ting"},"inventorship":null},{"name":{"value":"GIFFORD JAMES","valueNormalised":"Gifford James"},"inventorship":null},{"name":{"value":"HAN MAY","valueNormalised":"Han May"},"inventorship":null},{"name":{"value":"JIANG JINWEI","valueNormalised":"Jiang Jinwei"},"inventorship":null},{"name":{"value":"LERNER LORENA","valueNormalised":"Lerner Lorena"},"inventorship":null},{"name":{"value":"LIU QING","valueNormalised":"Liu Qing"},"inventorship":null},{"name":{"value":"MEETZE KRISTAN","valueNormalised":"Meetze Kristan"},"inventorship":null},{"name":{"value":"VINCENT SYLVIE","valueNormalised":"Vincent Sylvie"},"inventorship":null},{"name":{"value":"WEILER SOLLY","valueNormalised":"Weiler Solly"},"inventorship":null},{"name":{"value":"WINSTON JR WILLIAM M","valueNormalised":"Winston Jr William M"},"inventorship":null},{"name":{"value":"GYURIS JENO","valueNormalised":"Gyuris Jeno"},"inventorship":null}],"inventorships":[],"unmatchedInventorships":[],"activeUserHasInventorship":false},"simpleFamilyId":192267566,"citesPatentCount":14,"countrySpec":{"countryName":"USA","description":"GRANTED PATENT AS SECOND PUBLICATION [FROM 2001 ONWARDS]","rule":"pubdate:AFTER:01-01-2001","docType":"GRANTED_PATENT"},"pageTitle":"US 8829164 B2 - Anti-ron antibodies","documentTitle":"Anti-ron antibodies"},"claims":{"source":"xml_claims","claims":[{"lines":["An isolated antibody that binds human RON (Recepteur d'Origine Natais), comprising:\n
(i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 5 and SEQ ID NO: 124, a CDRH2 comprising the amino acid sequence of SEQ ID NO: 122, and a CDRH3 comprising the amino acid sequence of SEQ ID NO: 123; and\n
(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO: 130, a CDRL2 comprising the amino acid sequence of SEQ ID NO: 131, and a CDRL3 comprising the amino acid sequence of SEQ ID NO: 10."],"number":1,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 1, wherein the immunoglobulin heavy chain variable region comprises a CDRH1 comprising the amino acid sequence of SEQ ID NO: 5, a CDRH2 comprising the amino acid sequence of SEQ ID NO: 122, and a CDRH3 comprising the amino acid sequence of SEQ ID NO: 123; and\n
the immunoglobulin light chain variable region comprises a CDRL1 comprising the amino acid sequence of SEQ ID NO: 130, a CDRL2 comprising the amino acid sequence of SEQ ID NO: 131, and a CDRL3 comprising the amino acid sequence of SEQ ID NO: 10."],"number":2,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 1, wherein the CDR sequences are interposed between human framework sequences."],"number":3,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 1, wherein the immunoglobulin heavy chain variable region comprises a CDRH1 comprising the amino acid sequence of SEQ ID NO: 124, a CDRH2 comprising the amino acid sequence of SEQ ID NO: 122, and a CDRH3 comprising the amino acid sequence of SEQ ID NO: 123; and\n
the immunoglobulin light chain variable region comprises a CDRL1 comprising the amino acid sequence of SEQ ID NO: 130, a CDRL2 comprising the amino acid sequence of SEQ ID NO: 131, and a CDRL3 comprising the amino acid sequence of SEQ ID NO: 10."],"number":4,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 1, wherein the antibody is an antigen-binding fragment."],"number":5,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 1, wherein the immunoglobulin heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 137 and the immunoglobulin light chain variable region comprises the amino acid sequence of SEQ ID NO: 139."],"number":6,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 1, wherein the immunoglobulin heavy chain comprises the amino acid sequence of SEQ ID NO: 166, and the immunoglobulin light chain comprises the amino acid sequence of SEQ ID NO: 168."],"number":7,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 1, wherein the antibody binds human RON with a KD of 900 pM or lower as measured by surface plasmon resonance."],"number":8,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 8, wherein the antibody binds human RON with a KD of 500 pM or lower as measured by surface plasmon resonance."],"number":9,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 9, wherein the antibody binds human RON with a KD of 250 pM or lower as measured by surface plasmon resonance."],"number":10,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 1, wherein the CDR sequences are interposed between humanized framework sequences."],"number":11,"annotation":false,"claim":true,"title":false}]}},"filters":{"npl":[],"notNpl":[],"applicant":[],"notApplicant":[],"inventor":[],"notInventor":[],"owner":[],"notOwner":[],"tags":[],"dates":[],"types":[],"notTypes":[],"j":[],"notJ":[],"fj":[],"notFj":[],"classIpcr":[],"notClassIpcr":[],"classNat":[],"notClassNat":[],"classCpc":[],"notClassCpc":[],"so":[],"notSo":[],"sat":[]},"sequenceFilters":{"s":"SEQIDNO","d":"ASCENDING","p":0,"n":10,"sp":[],"si":[],"len":[],"t":[],"loc":[]}}