Anti-tau Nanobodies

Nanocorps anti-Tau

La présente invention concerne des nanocorps anti-Tau. II existe actuellement un consensus considérant la forme sporadique de la maladie d'Alzheimer (MA) comme un continuum, depuis une forme asymptomatique préclinique jusqu'à une maladie caractérisée cliniquement au moyen de tests cognitifs et mnésiques, ainsi qu'à l'aide de différents biomarqueurs (Dubois et al. Lancet Neurology. 13, 614-629 (2014)). Cependant, le développement de nouvelles stratégies thérapeutiques exige des méthodes diagnostiques permettant de détecter de façon précoce et de suivre les signes neurodégénératifs dans la population à risque afin de choisir les patients qui doivent être traités et pour contrôler les effets des traitements.

La MA est définie par l'association d'un syndrome de démence progressive et de deux lésions cérébrales caractéristiques: les plaques séniles extracellulaires (PA), composées de peptide amyloïde (Ab) et les dégénérescences neurofibrillaires (DNFs) composées d'agrégats de protéine Tau hyper-phosphorylée. Les DNFs apparaissent dans les structures enthorino-corticales avant que les PAs soient observées dans le cortex (Braak et al. Journal of Neuropathological Expérimental Neurology, 70 (1 1 ) : 960-969. (201 1 )). De plus la distribution corticale et le nombre des DNFs sont corrélés avec les troubles mnésiques chez le patients atteints de MA (Nelson et al. Journal of Neuropathological Expérimental Neurology, 71 (5): 362-381 (2012).). Récemment, il a été montré que les formes oligomèriques de Tau représentaient les formes toxiques (Usenovic et al. Journal of Neuroscience. 35 (42) : 14234-14250. (2015)) impliquées dans la propagation (Goedert et al. Current Neurology and Neuroscience 14 : 495 (2014) des tauopathies, telles que la MA, par contamination de proche en proche des neurones.

L'imagerie cérébrale nucléaire (tomographie à émission monophotonique (TEMP) et tomographie à émission de positon (TEP)) est un outil approprié pour déterminer la présence et l'évolution des lésions moléculaires liées à la MA (Dubois et al. Alzheimer's & Dementia. 12 (3): 292-323 (2016)). Des radioligands des PAs sont déjà disponibles (Catafau and Bullich. C//'n/'ca/ and Translational Imaging. 3 (1 ) : 39-55 (2015).) ainsi que quelques radiotraceurs. Des traceurs ciblant les feuillets beta au sein des DNFs sont actuellement en cours de développement. Deux d'entre eux, le 18F-AV-1451 (Ossenkoppele et al. Brain. 139 (5) : 1551 -1567 (2016).) et le 18F-THK51 17 (Jonasson et al. Journal of Nuclear Medicine. 57 (4) : 574-581 (2016).) pourraient faciliter la stratification des patients atteints de lésions de type DNFs. En revanche aucun ne permet la détection et le suivi des formes oligomèriques solubles de Tau. Dans les conditions physiologiques, la protéine Tau, très soluble, interagit avec les microtubules pour les stabiliser, sa phosphorylation partielle permettant son détachement alternatif des microtubules. La protéine Tau est normalement très soluble et se trouve sous forme non structurée Dans certaines conditions pathologiques, des modifications post-traductionnelles de Tau, en particulier une hyper-phosphorylation conduisent la protéine à se structurer et à former des agrégats : dimères, oligomères, fibres: paires hélicoïdales de filaments aboutissant à la formation des DNFs. Une importance prépondérante est actuellement attribuée aux oligomères de Tau, tant du point de vue de la toxicité que de la propagation des lésions de la MA et d'autres tauopathies.

Des scFv dirigés contre la protéine Tau sous forme d'oligomères, en particulier sous forme de dimères et trimères, ont été décrits dans la demande US 2015/0266947. Ces scFv, d'une taille d'environ 30 kDa, ne sont pas dirigés contre Tau sous forme de fibres.

Dans le but de développer de nouveaux marqueurs des formes pathologiques de Tau pour l'imagerie nucléaire ciblant les différentes formes agrégées de cette molécule, les présents inventeurs ont mis au point des nanobodies ou nanocorps (Nbs), en particulier des VHH, en ciblant les formes pathologiques, en particulier les formes pathologiques précoces de Tau, plus particulièrement Tau sous forme d'oligomères et éventuellement sous forme de fibres. Ces nanocorps sont ainsi susceptibles d'améliorer le diagnostic et le suivi de la MA, ainsi que l'évaluation des effets de traitements potentiels.

Ces nanobodies permettent également de cibler et donc identifier la présence des formes pathologiques de Tau dans d'autres tauopathies que la MA. Les nanobodies selon l'invention, qui sont en format VHH, sont de petits fragments d'anticorps correspondant aux domaines variables des chaînes lourdes de certains anticorps de camélidés. Ce sont les plus petits éléments fonctionnels (10-15 kDa) dérivés des immunoglobulines possédant un domaine de liaison à l'antigène et ils présentent des affinités envers l'antigène de l'ordre du nanomolaire. Du fait de leur structure simple sans domaine de type Fc et de leur poids moléculaire faible ce sont des outils appropriés pour traverser la barrière hémato-encéphalique (Caljon et al. British Journal of Pharmacology. 165 (7) : 2341 -2353 (2012).).

Résumé de l'invention

La présente invention se rapporte ainsi à un nanocorps qui se lie aux formes pathologiques de la protéine Tau, en particulier les formes pathologiques précoces de Tau, telles que Tau sous forme d'oligomères et éventuellement Tau sous forme de fibres.

La présente invention a donc pour objet un nanocorps dirigé contre la protéine Tau sous forme d'oligomères et dirigé contre la protéine Tau sous forme de fibres. La présente invention concerne également un nanocorps dirigé contre la protéine Tau, ladite protéine Tau étant sous forme d'oligomères et ledit nanocorps étant dépourvu de chaîne légère.

La présente invention a donc pour objet un nanocorps dirigé contre la protéine Tau, ladite protéine Tau étant sous forme pathologique, en particulier sous forme d'oligomères et ledit nanocorps entrant en compétition pour la liaison à la protéine Tau sous forme d'oligomères avec un nanocorps comprenant les séquences d'acides aminés (i) GRTFSXiX2X3 (SEQ ID NO: 1 ) comme CDR1 dans laquelle l'acide aminé ΧΊ est S ou R, X2 est D ou Y et X3 est T ou A,

(ii) ISX1SGGX2T (SEQ ID NO: 2) comme CDR2 dans laquelle l'acide aminé ΧΊ est P ou R et X2 est S ou V, et

(iii) NRDPKYGNTRY (SEQ ID NO: 5) ou TARRRISGTPQWHY (SEQ ID NO: 8) comme CDR3.

La présente invention se rapporte encore à un nanocorps dirigé contre la protéine Tau, ladite protéine Tau étant sous forme pathologique, en particulier sous forme d'oligomères et ledit nanocorps entrant en compétition pour la liaison à la protéine Tau sous forme d'oligomères avec un nanocorps comprenant :

a) les séquences d'acides aminés (i) GRTFSSDT (SEQ ID NO: 3) comme CDR1 , (ii) ISPSGGVT (SEQ ID NO: 4) comme CDR2 et (iii) NRDPKYGNTRY (SEQ ID NO: 5) comme CDR3 ; ou

b) les séquences d'acides aminés (i) GRTFSRYA (SEQ ID NO: 6) comme CDR1 , (ii) ISRSGGST (SEQ ID NO: 7) comme CDR2 et (iii) TARRRISGTPQWHY (SEQ ID NO:

8) comme CDR3.

La présente invention se rapporte également à des nanocorps dirigés contre la protéine Tau, lesdits nanocorps comprenant les séquences d'acides aminés :

(i) GRTFSX1X2X3 (SEQ ID NO: 1 ) comme CDR1 dans laquelle l'acide aminé ΧΊ est S ou R, X2 est D ou Y et X3 est T ou A,

(ii) ISX1SGGX2T (SEQ ID NO: 2) comme CDR2 dans laquelle l'acide aminé ΧΊ est P ou R et X2 est S ou V, et

(iii) NRDPKYGNTRY (SEQ ID NO: 5) ou TARRRISGTPQWHY (SEQ ID NO: 8) comme L'invention concerne encore des nanocorps, dirigés contre la protéine Tau, comprenant :

a) les séquences d'acides aminés (i) GRTFSSDT (SEQ ID NO: 3) comme CDR1 , (ii) ISPSGGVT (SEQ ID NO: 4) comme CDR2 et (iii) NRDPKYGNTRY (SEQ ID NO: 5) comme CDR3 ; ou

b) les séquences d'acides aminés (i) GRTFSRYA (SEQ ID NO: 6) comme CDR1 , (ii ISRSGGST (SEQ ID NO: 7) comme CDR2 et (iii) TARRRISGTPQWHY (SEQ ID NO: 8) comme CDR3 ; ou

un variant fonctionnellement conservatif du nanocorps défini en a) ou b) comprenant une substitution conservative d'un ou deux acides aminés dans respectivement une, deux ou trois des séquences SEQ ID NO: 3, SEQ ID NO: 4 et SEQ ID NO: 5, ou SEQ ID NO: 6, SEQ ID NO: 7 et SEQ ID NO: 8.

La présente invention concerne également le nanocorps tel que défini ci-dessus pour son utilisation comme agent de contraste dans l'imagerie médicale in vivo, non invasive, pour son utilisation dans des méthodes de diagnostic ou de pronostic, de préférence d'une tauopathie ou pour son utilisation comme médicament.

L'invention a également pour objet l'utilisation de ce nanocorps pour la détection in vitro de la protéine Tau, en particulier sous forme pathologique, de préférence une forme pathologique précoce, plus particulièrement sous forme d'oligomères et éventuellement sous formes de fibres, dans un échantillon.

Elle concerne enfin une composition pharmaceutique comprenant ce nanocorps en association avec un véhicule pharmaceutiquement acceptable.

Description détaillée de l'invention

Tauopathie

Le terme «tauopathie » regroupe une vingtaine de pathologies qui ont en commun l'existence de dépôts intracérébraux de protéine Tau, en particulier sous forme pathologique, et qui partagent des similitudes cliniques, pathologiques, biochimiques et génétiques. Le terme «dépôts intracérébraux de protéine tau» signifie la présence d'agrégats de Tau et donc la présence de Tau sous forme pathologique.

Certaines tauopathies, telles que la paralysie supranucléaire progressive, la dégénérescence corticobasale et la maladie de Gerstmann-Straussier-Scheinker, sont caractérisées par la présence des dégénérescences neurofibrillaires (DNFs) qui ne se distinguent pas de celles de la maladie d'Alzheimer. Dans ce cas le terme "dépôts intracérébraux de protéine tau" ou "présence des formes pathologiques de Tau" désigne par exemple la présence des dégénérescences neurofibrillaires (DNFs).

La maladie de Pick par exemple est caractérisée par des inclusions neuronales sphériques appelées corps de Pick. Ces corps de Pick sont constitués de filaments droits désorganisés et donc également d'une forme de Tau pathologique.

La « dégénérescence neurofibrillaire » (également appelée écheveaux ou enchevêtrements neurofibrillaires) désigne des zones, par exemple dans le cortex cérébral, à l'intérieur desquelles la population neuronale présente, autour du noyau et dans les prolongements cellulaires, des enchevêtrements fibrillaires constitués de filaments appariés organisés en hélice (PHF) et/ou de filaments droits (SF, en anglais « straight filaments).

Il faut noter que la formation des DNFs comprend l'agrégation de Tau, également nommée «agrégation fibrillaire» ou «fibrillogenèse». Pendant ce processus, la protéine Tau s'organise sous forme d'oligomères puis sous forme de fibres qui s'organise sous forme de paires hélicoïdales de filaments et sous formes de filaments droits. Les formes des paires hélicoïdales de filaments et les formes de filaments droits constituent les DNFs.

Le terme «forme pathologigue de Tau» englobe la protéine Tau sous forme d'oligomères, sous forme de fibres, sous forme de paires hélicoïdales de filaments et sous forme de filaments droits. Cependant, il a été découvert que les formes d'agrégation intermédiaires, c'est-à-dire Tau sous formes d'oligomères, et Tau sous forme de fibres, sont toxiques, les oligomères étant les plus toxiques. Celles-ci sont visées par le terme «formes pathologigues précoces de Tau» qui signifie donc en particulier Tau sous forme d'oligomères et sous formes de fibres, plus particulièrement tau sous forme oligomères.

La protéine Tau est une protéine intracellulaire, cependant les formes pathologiques de Tau peuvent, dont certaines cas, être extracellulaire.

Dans un mode de réalisation particulier, les formes pathologiques de Tau, de préférence Tau sous forme d'oligomères, sont extracellulaires.

En conséquence, dans un mode de réalisation « une forme pathologigue de Tau » se réfère à Tau sous forme d'oligomères, sous formes de fibres, sous forme de paires hélicoïdales de filaments et/ou sous formes de filaments droits. De préférence, une forme pathologique de Tau est une forme pathologique précoce de Tau, plus particulièrement Tau sous forme d'oligomères et éventuellement Tau sous forme de fibres, par exemple Tau sous forme d'oligomères ou Tau sous forme de fibres.

Dans un mode de réalisation, la tauopathie signifie une maladie qui est associée à l'existence des formes pathologiques de Tau, telles que définies ci-dessus. La tauopathie est choisie parmi la maladie d'Alzheimer, la paralysie supranucléaire progressive (ou la maladie de Steele-Richardson-OIzewski), la dégénérescence corticobasale, la maladie de Pick, la maladie de Niemann-Pick de type C, la maladie de Gerstmann-Straussler- Scheinker et la dégérescence fronto-temporale liée à une mutation du chromosome 17, de préférence la maladie d'Alzheimer, la paralysie supranucléaire progressive, la dégénérescence corticobasale et la maladie de Gerstmann-Straussler-Scheinker, en particulier la maladie d'Alzheimer.

Tau

Le terme «protéine Tau» ou «Tau» désigne la protéine Tau (en anglais : tubule- associated unit) qui est une protéine de mammifère. La protéine Tau est membre de la famille des protéines associées aux microtubules (protéines MAP (microtubule associating protein)). Elle est encodée par le gène MAPT localisé sur le chromosome 17, à la position 17q21 . La protéine Tau est également appelée MSTD; PPND; DDPAC; MAPTL; MTBT1 ; MTBT2; FTDP-17; PPP1 R103. Chez les humains, la protéine Tau est synthétisée essentiellement au niveau des neurones.

Le transcrit primaire de Tau contient 16 exons. Dans le cerveau, certains exons ne sont pas traduits. Les exons 2, 3 et 10 sont épissés de manière alternative et sont spécifiques du tissu cérébral adulte. L'épissage alternatif de ces 3 exons produit 6 combinaisons possibles (2-3-10- à 2+3+10+) Au niveau protéique, il y a donc six isoformes de protéines Tau dans le cerveau adulte. Il faut noter que l'expression des protéines Tau est régulée au cours du développement. Ainsi, une seule isoforme, dite fœtale, est présente à la naissance et ne comporte pas d'inserts codés par les exons 2, 3 ou 10. Les autres isoformes apparaissent au cours du développement ultérieur. La longueur de leurs séquences varie de 352 à 441 acides aminés.

La partie amino-terminale des protéines Tau, encore appelée domaine de projection, a un rôle encore mal connu. Ce domaine de projection pourrait interagir avec la membrane plasmique et certains organites comme les mitochondries. Quant au domaine carboxy-terminal, il comporte 3 (sans exon 10) ou 4 (avec exon 10) segments répétitifs, des domaines spécifiques de liaison (appelés 3R ou 4R) comportant le motif conservé de domaine de liaison à la tubuline, qui contrôle la stabilité des microtubules. Ces motifs R constituent le point d'ancrage de la protéine tau sur les microtubules. Les trois isoformes sans la séquence codée par l'exon 10 (10-) possèdent trois domaines de liaison aux microtubules (3R), sont nommées 2N3R, 1 N3R et 0N3R, et se distinguent par la partie amino-terminale. Les trois isoformes avec la séquence codée par l'exon 10 possèdent quatre domaines de liaison aux microtubules (4R), sont nommés 2N4R, 1 N4R et 0N4R, et se distinguent également par la partie amino-terminale. L'interaction avec les dimères de tubuline est plus forte avec ce quatrième domaine, ce qui stabilise davantage les microtubules et peut moduler la longueur des extensions neuritiques, ainsi que la plasticité neuronale.

Dans un mode de réalisation de l'invention, ladite protéine Tau est sélectionnée dans le groupe consistant en les isoformes 2N4R, 1 N4R, 0N4R, 2N3R, 1 N3R et 0N3R. De préférence la protéine Tau est sous l'isoforme 2N4R.

La séquence d'acides aminés de l'isoforme 2N4R de la protéine Tau, également appelée Tau-F ou Tau441 ou htau40, avec 441 acides aminés peut être trouvée sur la base de données UniprotKb dans sa version du 16 novembre 2016 sous le numéro d'accession P10636-8 (SEQ ID NO: 21 ).

La séquence d'acides aminés de l'isoforme 1 N4R de la protéine Tau, également appelée Tau-E ou Tau412, avec 412 acides aminés peut être trouvée sur la base de données UniprotKb dans sa version du 16 novembre 2016 sous le numéro d'accession P10636-7 (SEQ ID NO: 22).

La séquence d'acides aminés de l'isoforme 0N4R de la protéine Tau, également appelée Tau-D ou Tau383, avec 383 acides aminés peut être trouvée sur la base de données UniprotKb dans sa version du 16 novembre 2016 sous le numéro d'accession P10636-6 (SEQ ID NO: 23).

La séquence d'acides aminés de l'isoforme 2N3R de la protéine Tau, également appelée Tau-C ou Tau410, avec 410 acides aminés peut être trouvée sur la base de données UniprotKb dans sa version du 16 novembre 2016 sous le numéro d'accession P10636-5 (SEQ ID NO: 24).

La séquence d'acides aminés de l'isoforme 1 N3R de la protéine Tau, également appelée Tau-B ou Tau 381 , avec 381 acides aminés peut être trouvée sur la base de données UniprotKb dans sa version du 16 novembre 2016 sous le numéro d'accession P10636-5 (SEQ ID NO: 25).

La séquence d'acides aminés de l'isoforme 0N3R de la protéine Tau, également appelée Fetal-Tau ou Tau 352, avec 352 acides aminés peut être trouvée sur la base de données UniprotKb dans sa version du 16 novembre 2016 sous le numéro d'accession P10636-2 (SEQ ID NO: 26).

La protéine Tau est une protéine neuronale qui est localisée souvent dans l'axone, plus rarement dans les dendrites et exceptionnellement dans le corps cellulaire. Sous forme native, Tau est une protéine non structurée et sous forme d'un monomère. Par conséquent, dans le contexte de la présente invention, le terme « Tau native » signifie la protéine Tau sous forme monomérique et vice versa. La fonction des protéines tau sous forme native est d'interagir avec les microtubules via des domaines spécifiques de liaison (3R et 4R) et de favoriser l'assemblage et la stabilité des microtubules. L'interaction de la protéine Tau avec les microtubules est régulée principalement par la phosphorylation. Tau est une phosphoprotéine qui contient environ 80 sites potentiels de phosphorylation. La régulation de l'état de phosphorylation de la protéine Tau résulte des activités conjointes de protéines kinases et de protéines phosphatases.

En général, une hyperphosphorylation de la protéine Tau, en particulier dans les domaines spécifiques de liaison (3R et 4R), diminue son affinité pour les microtubules, ce qui peut entraîner leur déstabilisation et par conséquent une désorganisation du cytosquelette. En outre, cette hyperphosphorylation peut entraîner l'agrégation de Tau et donc la formation des DNFs, comme décrit ci-dessus dans la partie «tauopathie».

L'homme du métier distingue la phosphorylation anormale et l'hyperphosphorylation de la protéine Tau.

La « phosphorylation anormale » consiste en la phosphorylation en des sites qui dans des conditions physiologiques ne sont pas concernés par la phosphorylation. On parle d'épitope non-physiologique ; ce sont par exemple les épitopes reconnus par les anticorps AT100 et TG-3.

En revanche, le terme « hvperphosphorylée » signifie une phosphorylation au niveau d'épitopes physiologiques en plus grand nombre que dans un cerveau adulte normal ou lorsque pour un site donné un pourcentage élevé de protéine Tau est phosphorylé.

L'hyperphosphorylation de la protéine tau peut entraîner le détachement de tau des microtubules et une augmentation de la concentration intracellulaires de tau provoquant la formation d'oligomères puis de fibres, jusqu'à aboutir à la formation de paires hélicoïdales de filaments et de filaments droit dont l'enchevêtrement vont constituer les dégénérescences fibrillaires. Le résultat est une accumulation de protéine tau dans les neurones et concerne plus de 20 maladies neurodégénératives différentes dénommées tauopathie. L'accumulation de la protéine Tau est même parfois la seule cause d'une telle tauopathie.

II est connu de l'homme du métier que l'agrégation de Tau peut être étudiée en utilisant la protéine Tau non-phosphorylée (Xu, S et al. Alzheimers Dément. 2010 Mar;6(2):1 10-7, Kumar S. et al. J Biol Chem. 2014 Jul 18;289(29):20318-32 ; Flach, K et al. J Biol Chem. 2012 Dec 21 ;287(52):43223-33).

Les inventeurs de la présente invention ont mis au point les nanocorps de l'invention dirigés contre la protéine Tau non-phosphorylée, en particulier sous forme d'oligomères. Cependant, comme démontré par immunohistochimie, les nanobodies de l'invention se lient également de façon spécifique à la protéine Tau dans des dégénérescences neurofibrillaires de coupes de cerveaux humains dans lesquels la protéine Tau est présente sous forme phosphorylée.

En conséquence, dans un mode de réalisation de l'invention la protéine Tau est non-phosphorylée et/ou phosphorylée.

Dans certaines dépôts intracérébraux de protéine Tau, celle-ci peut également être dégradée et perdre la partie N-terminale en conservant les domaines de liaison aux microtobules. Cette protéine Tau tronquée comprend la partie carboxy-terminale des protéines Tau, et donc, selon l'isoforme de départ soit la région 3R (R1 , R2, R3, R4) soit la région 4R (R1 , R3 et R4). Cette protéolyse favorise la formation des fibres et puis l'agrégation des paires de filaments en hélice qui deviennent insolubles et sont également indicateurs de certaines Tauopathies.

En conséquence, dans une mode de réalisation la protéine Tau est une protéine Tau tronquée comprenant la partie carboxy-terminale de la protéine Tau, en particulier la région R3 ou R4 des motifs répétés de Tau, de manière préférée la région R3. De préférence, la protéine Tau tronquée est dépourvue des domaines N-terminaux. Dans une mode de réalisation particulier la protéine Tau comprend ou consiste en un peptide ayant la séquence d'acides aminés VQIVYKPVDLSKVTSKCG (SEQ ID NO : 27) qui correspond aux acides aminé 306 à 323 de tau441 , telle que défini ci-dessus. Nanocorps anti-Tau

Dans le contexte de la présente invention, les termes "anticorps" et

"immunoqlobuline" ont la même signification et sont utilisés indifféremment. Dans les anticorps conventionnels, les deux chaînes lourdes sont liées l'une à l'autre par des ponts disulfures et chaque chaîne lourde est liée à une chaîne légère par un pont disulfure. Il y a deux types de chaîne légère : les chaînes légères lambda (λ) et kappa (κ). Il existe cinq principales classes de chaînes lourdes (ou isotypes) qui déterminent l'activité fonctionnelle d'un anticorps : IgM, IgD, IgG, IgA et IgE. Chaque chaîne contient des domaines de séquence distincts. La chaîne légère comprend deux domaines : un domaine variable (VL) et un domaine constant (CL). La chaîne lourde comprend quatre domaines : un domaine variable (VH) et trois domaines constants (CH1 , CH2 et CH3, collectivement nommés CH). Les régions variables des chaînes lourde (VH) et légère (VL) déterminent la reconnaissance de liaison et la spécificité à l'antigène. Les domaines des régions constantes des chaînes légère (CL) et lourde (CH) confèrent des propriétés biologiques importantes telles que l'association des chaînes des anticorps, la sécrétion, la mobilité transplacentaire, la liaison au complément et la liaison aux récepteurs Fc. Le fragment Fv est la partie N-terminale du fragment Fab d'une immunoglobuline consistant en les portions variables d'une chaîne légère et d'une chaîne lourde. La spécificité de l'anticorps réside dans la complémentarité structurale entre le site de combinaison de l'anticorps et le déterminant antigénique. Les sites de combinaison de l'anticorps sont faits de résidus qui proviennent principalement des régions hypervariables ou régions de détermination de la complémentarité (CDRs). Occasionnellement, des résidus provenant des régions non-hypervariables ou régions "charpente" ("framework", FR) peuvent influencer la structure globale du domaine et par conséquent le site de combinaison.

Dans le contexte de l'invention, le terme "CDR" fait référence aux séquences d'acides aminés, qui, ensemble, définissent l'affinité de liaison et la spécificité de la région Fv naturelle d'un site de liaison natif d'une immunoglobuline. Les chaînes lourde et légère d'une immunoglobuline ont chacune trois CDRs, désignés H-CDR1 , H-CDR2, H-CDR3 et L-CDR1 , L-CDR2, L-CDR3 respectivement. Un site de liaison à l'antigène inclut donc 6 CDRs, comprenant l'ensemble des CDRs d'une région variable d'une chaîne lourde et d'une région variable d'une chaîne légère.

La localisation des CDRs dans la séquence d'un anticorps ou d'un nanocorps peut être déterminée par l'homme du métier en utilisant des techniques précédemment décrites. Typiquement, les CDRs peuvent être identifiés en séquençant l'ADN de l'anticorps ou du nanocorps avec un système approprié, tel que le 3730XL DNA Analyser et ABI PRISM BigDye Terminator cyc, puis en analysant les séquences ainsi obtenues à l'aide de bases de données dédiées telle que le international ImMunoGeneTics database ou IMTG (Lefranc (2003) Dev. Comp. Immunol. 27:55) ou Kabat, et al. (Séquences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md., 1991 ), de préférence IMGT.

Dans le contexte de l'invention, le terme "région charpente", "framework" ou "FR" font référence aux séquences d'acides aminés intercalées entre les CDRs.

Dans le contexte de l'invention, les termes "nanocorps", "nanobody", "VHH", "fragment d'anticorps VHH" et "anticorps à domaine unigue" sont utilisés indifféremment et désignent le domaine variable de la chaîne lourde unique d'anticorps du type de ceux trouvés chez les camélidés, qui sont naturellement dépourvus de chaînes légères. En absence de chaîne légère les nanocorps ont chacun trois CDRs, désignés CDR1 , CDR2, et CDR3 respectivement. Les nanocorps selon l'invention peuvent en particulier être des nanocorps de chameaux, de dromadaires, de lamas ou d'alpagas. De préférence, les nanocorps selon l'invention sont des nanocorps de lamas.

Par "nanocorps dirigé contre la protéine Tau", on entend ici un nanocorps capable de se lier de manière sélective à la protéine Tau, telle que définie dans la section « Tau ». Préférentiellement, le nanocorps est spécifique de Tau, c'est-à-dire qu'il se lie à Tau à l'exclusion de toute autre molécule.

Les inventeurs ont préparé des nanocorps dirigés contre des formes pathologiques de la protéine Tau, telles que la protéine Tau sous forme d'oligomères et éventuellement sous forme de fibres. Les nanocorps peuvent également être dirigés contre la protéine Tau tronquée sous formes de fibres.

En particulier, les inventeurs ont immunisé des lamas avec une préparation de protéines Tau enrichie en protéine Tau sous forme d'oligomères, avec une préparation de protéines Tau enrichie en protéine Tau sous forme de fibres et une préparation de protéines Tau tronquées enrichie en protéine Tau tronquée sous forme de fibres. Les inventeurs ont ensuite identifié plus précisément deux nanocorps dirigés contre Tau et présentant des caractéristiques additionnelles non attendues que ne possèdent pas d'autres nanocorps anti-Tau. En effet, ces deux nanocorps, 2C5 et S2T2M3_E6, en particulier 2C5, reconnaissent Tau sous forme d'oligomères et éventuellement sous formes de fibres. La protéine Tau sous forme de fibres est également reconnue quand il s'agit d'une protéine Tau tronquée telle que définie ci-dessus. En même temps ces deux nanocorps, 2C5 et S2T2M3_E6, en particulier 2C5, ne se lient pas à la protéine Tau native, sous forme de monomère. En outre, ces deux nanocorps, 2C5 et S2T2M3_E6, en particulier 2C5, ne se lient pas aux fibres de peptide beta amyloïde.

En conséquence, dans un mode de réalisation préféré, les nanocorps sont dirigés contre la protéine Tau sous forme d'oligomères.

Le terme « oliqomères » dans le contexte de la présente invention concerne une préparation de Tau obtenue par un procédé de fibrillation in vitro tel que décrit dans les exemples de cette demande. Typiquement, la fibrillation de Tau (40 μΜ) est réalisée par exemple à 37°C dans du tampon, par exemple, MOPS (acide 3-(N-morpholino) propane sulfonique) typiquement 20 mM, typiquement à pH 7 en présence typiquement d'héparine (10 μΜ), de NaN3 (4%) pour un volume final de typiquement 1 ,5 ml. La fibrillation est stoppée typiquement par congélation des échantillons à -80°C au bout de typiquement 48 heures pour obtenir Tau sous forme d'oligomères. Selon le temps exact de fibrillation cette préparation de protéines Tau est enrichie en protéine Tau sous forme d'oligomères.

Le terme « enrichie en protéine Tau sous forme d'oligomères» signifie une préparation de protéines Tau sous forme d'oligomères dont plus de 50% de protéines Tau sont sous forme d'oligomères. Par exemple plus de 50%, plus de 55%, plus de 60%, plus de 70%, plus de 75%, plus de 80%, plus de 85%, plus de 90% des protéines Tau sont sous forme d'oligomères. Il est connu de l'homme du métier qu'une préparation enrichie en protéines Tau sous forme d'oligomères contient en outre de la protéine Tau sous forme native et de la protéine Tau sous forme de fibres.

En conséquence, dans un mode de réalisation, la protéine Tau sous forme d'oligomères est un mélange de protéines Tau sous forme de monomères, sous forme d'oligomères et sous forme de fibres, dont plus de 50% des protéines Tau sont sous forme d'oligomères, en particulier plus de 55%, plus de 60%, plus de 70%, plus de 75%, plus de 80%, plus de 85%, plus de 90% des protéines Tau sont sous forme d'oligomères.

Il est également connu de l'homme du métier qu'il est possible de purifier la protéine Tau sous formes d'oligomères à partir d'une telle préparation, en utilisant plusieurs méthodes connues de l'homme du métier, dont par exemple la chromatographie d'exclusion stérique.

Les oligomères comprennent de préférence entre 2 et 45 unités de Tau. Des oligomères ayant 2 à 8 unités de Tau sont appelés oligomères solubles et les oligomères ayant plus de 8 jusqu'à 45 unités de Tau sont appelés oligomères granulaires et peuvent être solubles ou non solubles. Dans un mode de réalisation ces oligomères peuvent être caractérisées, en utilisant un microscope à force atomique ou microscope électronique, comme étant des points ronds ayant un diamètre d'environ 12 à 29 nm.

Dans un autre mode de réalisation ces oligomères peuvent être caractérisés en utilisant une chromatographie d'exclusion stérique comme étant des molécules sphériques ayant un diamètre d'environ 12 à 35 nm.

En conséquence, le terme «oliqomère» dans le contexte de l'invention fait référence à un agrégat ou polymère de Tau ayant de 2 jusqu'à 50 unités de Tau, en particulier 2 à 20, de manière préférée 2 à 12 unités de tau, par exemple un dimère, un trimère, un tétramère, un pentamère, un hexamère, heptamère, octamère, nonamère, décamère, undécamère ou dodécamère de Tau ou ayant 20 à 45, de préférence, 30 à 45 unités de Tau, par exemple 35 à 45, de préférence 38 à 42 unités de Tau. Dans certains modes de réalisation, la protéine tau est dimérique ou trimérique. Dans certains modes de réalisation, la protéine Tau sous forme d'oligomères est soluble et/ou non soluble, de manière plus préférée soluble.

Dans une mode de réalisation le nanocorps de l'invention a une affinité pour la protéine Tau sous forme d'oligomères qui est < 20nM, par exemple < 10nM, < 8nM, < 7nM ou < 5nM, par exemple une affinité de 0.1 nM à 20 nM, en particulier de 1 nM à 10 nM, ou de 1 nM à 7 nM, par exemple 5 nM.

Par « affinité » on entend la capacité de fixation entre une macromolécule et l'antigène qu'elle fixe, en particulier la capacité de fixation entre un nanocorps et l'antigène qu'il fixe, par exemple un nanocorps de l'invention et la protéine Tau sous les formes pathologiques telles que définies ci-dessus.

L'affinité et donc la capacité du nanocorps de l'invention à se lier à la protéine Tau, par exemple sous forme d'oligomère ou de fibres, peut être mesurée in vitro par plusieurs méthodes, dont la résonance plasmonique de surface (RPS, notamment à l'aide d'un appareil type BIAcore 2000- Pharmacia Biosensor, Upsala, Suède) ou par exemple par un test ELISA, comme décrit dans les exemples.

Dans une mode de réalisation les nanocorps de l'invention se lient en outre à la protéine Tau sous forme de fibres.

Le terme « fibres » dans le contexte de l'invention concerne une préparation de la protéine Tau obtenue par un procédé de fibrillation tel que décrit dans les exemples de cette demande. Typiquement, la fibrillation de Tau (40 μΜ) est réalisée par exemple à 37°C dans du tampon, par exemple, MOPS (acide 3-(N-morpholino) propane sulfonique) typiquement 20 mM, typiquement à pH 7 en présence typiquement d'héparine (10 μΜ), de NaN3 (4%) pour un volume final de typiquement 1 ,5 ml. La fibrillation est stoppée typiquement par congélation des échantillons à -80°C au bout de typiquement 72 heures pour obtenir Tau sous forme de fibres. Une telle préparation de protéines Tau sous forme de fibres est donc une préparation de protéines Tau enrichie en protéine Tau sous forme de fibres.

Le terme « enrichie par Tau sous forme de fibres» signifie une préparation de protéines Tau sous forme de fibres dont plus de 50% des protéines Tau sont sous forme de fibres. Par exemple plus de 50%, plus de 55%, plus de 60%, plus de 70%, plus de 75%, plus de 80%, plus de 85%, plus de 90% des protéines Tau sont sous forme de fibres. Il est connu de l'homme du métier qu'une préparation enrichie en protéines Tau sous forme de fibres contient en outre de la protéine Tau sous forme native et de la protéine Tau sous forme d'oligomères.

En conséquence, dans un mode de réalisation, la protéine Tau sous forme de fibres est un mélange de protéines Tau sous forme de monomères, sous forme d'oligomères et sous forme de fibres, dont plus de 50% des protéines Tau sont sous forme de fibres, en particulier plus de 55%, plus de 60%, plus de 70%, plus de 75%, plus de 80%, plus de 85%, plus de 90% des protéines Tau sont sous forme de fibres.

Il est également connu de l'homme du métier qu'il est possible de purifier la protéine Tau sous formes de fibres à partir d'une telle préparation, en utilisant plusieurs méthodes connu de l'homme du métier, dont par exemple la chromatographie d'exclusion stérique. Dans le contexte de l'invention, le terme fibre décrit un polymère ou agrégat de Tau obtenu d'une façon artificielle mimant la fibrillation de Tau in vivo et donc mimant les paires hélicoïdales de filaments et les filaments droits qui composent les DNFs. En conséquence, les fibres de Tau telles qu'utilisées dans le contexte de l'invention englobe les paires de filaments en hélice et les filaments droits. Par microscopie électronique ces fibres peuvent être caractérisées comme ayant une apparence filamenteuse. Dans un mode de réalisation le nanocorps de l'invention a une affinité pour la protéine Tau sous forme de fibres qui est < 20nM, par exemple < 10nM, < 8nM, < 7nM ou < 6nM, par exemple une affinité de 0.1 nM à 20 nM, en particulier de 1 nM à 10 nM, ou de 1 nM à 8 nM, par exemple 6 nM.

Dans un autre mode de réalisation les nanocorps de l'invention se lient en outre à la protéine Tau tronquée. De préférence, cette protéine tronquée est sous forme de fibres et peut également être nommé fibres de peptide R3. La protéine Tau tronquée est telle que définie dans la section «Tau» ci-dessus. En particulier, cette protéine Tau tronquée comprend ou consiste en la séquence d'acides aminés SEQ ID NO : 27.

Dans un mode de réalisation le nanocorps de l'invention a une affinité pour la protéine Tau tronquée sous forme de fibres qui est < 100nM, par exemple < 80nM, < 70nM, < 60nM ou < 50nM, par exemple une affinité de 1 nM à 100 nM, en particulier de 1 nM à 80 nM, ou de 40 nM à 60 nM, par exemple 50 nM.

Dans un mode de réalisation le nanocorps de l'invention a une affinité pour la protéine Tau tronquée sous forme de fibres qui est < 100nM, par exemple une affinité de 1 nM à 100 nM, en particulier de 1 nM à 80 nM, de 1 nM à 20nM, par exemple une affinité de 10 à 20nM.

Dans le contexte de l'invention, « la protéine Tau tronquée sous forme de fibres » ou « les fibres de peptide R3 » concerne une préparation de peptide R3 obtenue par un procédé de fibrillation in vitro tel que décrit dans les exemples de cette demande.

Typiquement, la fibrillation de R3 (0.4 μΜ) est réalisée par exemple à 37°C dans du tampon, par exemple, PBS (phosphate buffer saline 50 mM, typiquement à pH 7 en présence typiquement d'héparine (0.4 μΜ), de NaN3 (4%) pour un volume final de typiquement 1 ,5 ml. La fibrillation est stoppée typiquement par congélation des échantillons à -80°C au bout de typiquement 72 heures pour obtenir Tau tronquée (R3) sous forme de fibres.

Dans un exemple l'affinité pour la protéine Tau tronquée sous forme de fibres est mesurée, par exemple, par ELISA, dans, par exemple, un tampon Phosphate Buffer Saline (NaCI, 137mM ; KCI, 2.7mM ; Na2HP04, 10mM KH2P04, 1 .8mM) comprenant, par exemple, BSA 1 % et- ayant, par exemple un pH de 7.5.

Les inventeurs ont également démontré pour les nanocorps de l'invention un marquage spécifique des corps cellulaires de l'hippocampe, du cortex entorhinal et du cortex temporal chez des patients atteints de la maladie d'Alzheimer.

En conséquence, dans un mode de réalisation les nanocorps de l'invention se lient en outre aux paires hélicoïdales de filaments et/ou les filaments droits.

Le terme «paires hélicoïdales de filaments» désigne des filaments appariés en hélice comprenant au moins 10, au moins 12, au moins 20, de préférence au moins 40 unités de Tau, en particulier au moins 50 ou au moins 60 unités de Tau. Normalement ces filaments peuvent être observés en microscopie électronique et ont un diamètre de 8 à 20 nanomètres, par exemple 10 à 20 nm et un pas d'hélice d'environ 80 nm, par exemple 70 jusqu'à 90nm.

Le terme « filaments droits » signifie des filaments qui ne sont pas appariés en hélice et comprenant au moins 10, au moins 12, au moins 20, de préférence au moins 40 unités de Tau, en particulier au moins 50 ou au moins 60 unités de Tau. Normalement ces filaments peuvent être observés en microscopie électronique et ont un diamètre d'environ 10 nanomètres, par exemple de 8 à 17nm, en particulier de 9 à 12nm, par exemple 10 nm.

Les paires hélicoïdales de filaments et les filaments droits qui composent les DNFs ne sont pas solubles.

Dans un autre mode de réalisation les nanocorps de l'invention n'interagissent pas substantiellement avec la protéine amyloïde beta 1 -42 polymérisée.

Dans un mode de réalisation les nanocorps n'interagissent pas substantiellement avec la protéine Tau sous forme monomérique.

Un nanocorps « n'interaqit pas substantiellement » avec une protéine, par exemple la protéine amyloïde beta 1 -42 polymérisé ou Tau sous forme monomérique, lorsque les affinités pour la protéine Tau sous forme d'oligomère et l'affinité pour la protéine Tau sous forme de monomère ou la protéine amyloïde beta 1 -42 polymérisé sont très différentes. Dans un exemple, l'affinité pour la protéine Tau sous forme monomérique ne peut pas être mesurée car la réponse de liaison est trop faible. Dans un autre exemple, un nanocorps n'interagit pas substantiellement avec la protéine Tau sous forme monomérique ou la protéine amyloïde beta 1 -42 polymérisé, lorsque la réaction de liaison du nanocorps avec Tau sous forme de monomère est inférieure à 5% de la réponse de liaison du même nanocorps avec Tau sous forme d'oligomère dans la même condition expérimentale et à la même concentration du nanocorps. Dans la pratique, la concentration du nanocorps utilisée peut être la concentration CE50 ou la concentration nécessaire pour atteindre le plateau de saturation.

Par exemple, l'affinité des nanocorps de l'invention pour la protéine Tau sous forme monomérique est > 1200 nM, par exemple > 1400 nM, > 1600 nM, > 1800 nM, en particulier > 1800 nM.

Par exemple, l'affinité des nanocorps de l'invention pour la protéine amyloïde beta 1 -42 polymérisée est > 5000 nM, par exemple> 8000 nM, > 9000 nM, > 10000 nM, en particulier > 10000 nM.

Les nanocorps de l'invention ont été séquencés :

- le nanocorps 2C5 présente la séquence d'acides aminés QVQLVQSGG

GLVQAGGSLRLSCAASGRTFSSDTLAWFRQAPGKEREFVASISPSGGV TYYEDSVK.GRFTISRDNSKNTVLLQMNSLTPEDTAVYYCNRDPKYGNT RYWGQGTQVTVSS (SEQ ID NO: 9),

le nanocorps S2T2M3_E6 présente la séquence d'acides aminés EVQLVESGGGLVQAGGSLRLSCAASGRTFSRYAMGWFRQAPGKEREF

VASISRSGGSTRYADAVKGRFTISRDNTNNTVYLLMNNLKPEDTAVYYC TARRRISGTPQWHYWGQGTQVTVSS (SEQ ID NO: 10).

Les CDRs de ces deux nanocorps ont été plus spécifiquement séquencés et sont les suivants :

· 2C5

o CDR1 : GRTFSSDT (SEQ ID NO: 3)

o CDR2 : ISPSGGVT (SEQ ID NO: 4)

o CDR3 : NRDPKYGNTRY (SEQ ID NO: 5)

• S2T2M2_E6

o CDR1 : GRTFSRYA (SEQ ID NO: 6)

o CDR2 : ISRSGGST (SEQ ID NO: 7)

o CDR3: TARRRISGTPQWHY (SEQ ID NO: 8)

Comme il est bien connu de l'homme du métier, la combinaison des CDR1 , CDR2 et CDR3 suffit pour définir un site de liaison à l'antigène. Il est également connu par l'homme de métier que deux nanocorps qui reconnaissent le même antigène entrent en compétition pour la liaison à cet antigène.

En conséquence, un objet de l'invention concerne un nanocorps dirigé contre la protéine Tau, ladite protéine Tau étant sous forme pathologique, en particulier sous forme d'oligomères et ledit nanocorps entrant en compétition pour la liaison à la protéine Tau sous forme d'oligomères avec un nanocorps comprenant les séquences d'acides aminés (i) GRTFSX1X2X3 (SEQ ID NO: 1 ) comme CDR1 dans laquelle l'acide aminé ΧΊ est S ou R, X2 est D ou Y et X3 est T ou A,

(ii) ISX1SGGX2T (SEQ ID NO: 2) comme CDR2 dans laquelle l'acide aminé ΧΊ est P ou R et X2 est S ou V, et

(iii) NRDPKYGNTRY (SEQ ID NO: 5) ou TARRRISGTPQWHY (SEQ ID NO: 8) comme CDR3.

La capacité d'un nanocorps candidat à entrer en compétition pour la liaison à la protéine Tau, par exemple sous forme d'oligomères, avec un nanocorps comprenant les CDR d'un nanocorps 2C5 et/ou S2T2M3_E6 tels que définis ci-dessus, (ci-après un nanocorps «de référence») peut être facilement vérifiée, par exemple, par ELISA compétitive dans laquelle l'antigène (à savoir la protéine Tau sous forme d'oligomères) est lié à un support solide et deux solutions contenant le nanocorps candidat et le nanocorps de référence, respectivement, sont ajoutés et les nanocorps vont entrer en compétition pour se lier à l'antigène. La quantité de nanocorps de référence lié à l'antigène peut ensuite être mesurée et comparée à la quantité de nanocorps de référence lié à l'antigène lorsqu'il est mesuré contre un contrôle négatif (solution par exemple dépourvue de nanocorps de candidat). Une quantité de nanocorps de référence lié en présence de nanocorps candidat qui est diminuée par rapport à la quantité de nanocorps de référence lié en présence du témoin négatif indique que le nanocorps candidat entre en compétition pour la liaison à la protéine Tau sous forme d'oligomères. Idéalement, le nanocorps de référence peut être marqué (par exemple par fluorescence) pour faciliter la détection des nanocorps de référence liés. Des mesures répétées peuvent être réalisées avec des dilutions successives du candidat et/ou nanocorps de référence.

Dans un autre objet de l'invention, l'invention concerne un nanocorps dirigé contre la protéine Tau, ladite protéine Tau étant sous forme pathologique, en particulier sous forme d'oligomères et ledit nanocorps entrant en compétition pour la liaison à la protéine Tau sous forme d'oligomères avec un nanocorps choisi parmi un nanocorps comprenant : a) les séquences d'acides aminés (i) GRTFSSDT (SEQ ID NO: 3) comme CDR1 , (ii) ISPSGGVT (SEQ ID NO: 4) comme CDR2 et (iii) NRDPKYGNTRY (SEQ ID NO: 5) comme CDR3 ; ou

b) les séquences d'acides aminés (i) GRTFSRYA (SEQ ID NO: 6) comme CDR1 , (ii) ISRSGGST (SEQ ID NO: 7) comme CDR2 et (iii) TARRRISGTPQWHY (SEQ ID NO: 8) comme CDR3. Un objet de la présente invention concerne un nanocorps dirigé contre la protéine

Tau comprenant les séquences d'acides aminés (i) GRTFSX1X2X3 (SEQ ID NO: 1 ) comme CDR1 dans laquelle l'acide aminé ΧΊ est S ou R, X2 est D ou Y et X3 est T ou A,

(ii) ISX1SGGX2T (SEQ ID NO: 2) comme CDR2 dans laquelle l'acide aminé ΧΊ est P ou R et X2 est S ou V, et

(iii) NRDPKYGNTRY (SEQ ID NO: 5) ou TARRRISGTPQWHY (SEQ ID NO: 8) comme CDR3.

L'invention concerne également un nanocorps dirigé contre la protéine Tau comprenant : a) les séquences d'acides aminés (i) GRTFSSDT (SEQ ID NO: 3) comme CDR1 , (ii) ISPSGGVT (SEQ ID NO: 4) comme CDR2 et (iii) NRDPKYGNTRY (SEQ ID NO: 5) comme CDR3 ; ou

b) les séquences d'acides aminés (i) GRTFSRYA (SEQ ID NO: 6) comme CDR1 , (ii ISRSGGST (SEQ ID NO: 7) comme CDR2 et (iii) TARRRISGTPQWHY (SEQ ID NO: 8) comme CDR3 ; ou

un variant fonctionnellement conservatif du nanocorps défini en a) ou b) comprenant une substitution conservative d'un ou deux acides aminés dans respectivement une, deux ou trois des séquences SEQ ID NO: 3, SEQ ID NO: 4 et SEQ ID NO: 5, ou SEQ ID NO: 6, SEQ ID NO: 7 et SEQ ID NO: 8.

Dans un mode de réalisation préféré cette protéine Tau est sous forme d'oligomères et éventuellement sous forme de fibres.

Les inventeurs ont également séquencé les régions "charpente" (FR) des nanocorps 2C5 et S2T2M2 E6. Les séquences correspondantes sont les suivantes :

• 2C5

o Région FR1 : QVQLVQSGGGLVQAGGSLRLSCAAS (SEQ ID NO: 1 1 ) o Région FR2 : LAWFRQAPGKEREFVAS (SEQ ID NO: 12)

o Région FR3 : YYEDSVKGRFTISRDNSKNTVLLQMNSLTPEDTAVYYC (SEQ ID NO: 13)

o Région FR4 : WGQGTQVTVSS (SEQ ID NO: 14)

• S2T2M2_E6

o Région FR1 : EVQLVESGGGLVQAGGSLRLSCAAS (SEQ ID NO: 15) o Région FR2 : MGWFRQAPGKEREFVAS (SEQ ID NO: 16)

o Région FR3 : RYADAVKGRFTISRDNTNNTVYLLMNNLKPEDTAVYYC (SEQ ID NO: 17)

o Région FR4 : WGQGTQVTVSS (SEQ ID NO: 18)

Dans un mode de réalisation particulier, l'invention concerne un nanocorps dirigé contre la protéine Tau, ladite protéine Tau étant sous forme pathologique, en particulier sous forme d'oligomères et ledit nanocorps entrant en compétition pour la liaison à la protéine Tau sous forme d'oligomères avec un nanocorps choisi parmi un nanocorps comprenant une séquence d'acides aminés sélectionnée dans le groupe consistant en les séquences d'acides aminés SEQ ID NO: 9 et SEQ ID NO: 10.

Dans un mode de réalisation particulier, l'invention concerne un nanocorps comprenant ou consistant en l'enchaînement de séquences FR1 -CDR1 -FR2-CDR2-FR3- CDR3-FR4 telles que définies ci-dessus de l'un des nanocorps identifiés par les inventeurs.

De préférence, le nanocorps selon l'invention est donc un nanocorps comprenant ou consistant en une séquence d'acides aminés sélectionnée dans le groupe consistant en les séquences d'acides aminés SEQ ID NO: 9 et SEQ ID NO: 10 ou un variant fonctionnellement conservatif de celui-ci comprenant une substitution conservative d'un ou deux acides aminés dans un, deux ou trois des CDRs compris respectivement dans la séquence d'acides aminé SEQ ID NO: 9 ou SEQ ID NO: 10. Le variant fonctionnellement conservatif tel que défini ci-dessus peut en outre comprendre une ou plusieurs substitutions, en particulier une ou plusieurs substitutions conservatives dans les régions respectivement des séquences d'acides aminés SEQ ID NO: 9 ou SEQ ID NO: 10 qui ne sont pas des CDRs, telles que les régions "charpente", en particulier les régions "charpente" définies ci-dessus. De manière davantage préférée, le nanocorps selon l'invention est un nanocorps comprenant ou consistant en une séquence d'acides aminés sélectionnée dans le groupe consistant en les séquences d'acides aminés SEQ ID NO: 9 et SEQ ID NO: 10. De manière préférée entre toutes, le nanocorps selon l'invention est un nanocorps comprenant ou consistant en la séquence d'acides aminés SEQ ID NO: 9.

Dans le contexte de l'invention, l'expression "variant fonctionnellement conservatif" fait référence à des variants dans lesquels un acide aminé donné dans un nanocorps selon l'invention est substitué sans altérer la conformation globale et la fonction du nanocorps, incluant un remplacement d'un acide aminé par un autre ayant des propriétés similaires (par exemple polarité, potentiel de liaison hydrogène, acidité, basicité, hydrophobicité, présence d'un groupe aromatique, etc). Les acides aminés ayant des propriétés similaires sont bien connus de l'homme du métier. Par exemple, l'arginine, l'histidine et la lysine des acides aminés hydrophiles-basiques et peuvent être interchangeables. De manière similaire, l'isoleucine, un acide aminé hydrophobe, peut être remplacé par la leucine, la méthionine ou la valine. De tels changements devraient avoir peu ou pas d'effet sur le poids moléculaire apparent ou le point isoélectrique du nanocorps. Un acide aminé naturel peut être remplacé par un acide aminé non naturel, tel qu'un acide aminé en configuration D, acide aminé bêta ou gamma. Des exemples de substitutions conservatives sont présentés dans le tableau 1 ci- dessous.

Tableau 1 : Substitutions conservatives I

Alternativement, les acides aminés conservatifs peuvent être groupés comme décrit dans Lehninger (1975, Biochemistry, 2nde Edition, Worth Publishers, Inc. New- York: NY., p. 71 -77), comme montré dans le tableau 2 ci-dessous.

Tableau 2: Substitutions conservatives II

Selon une autre alternative, des exemples de substitutions conservatives sont présentés dans le tableau 3 ci-dessous.

Tableau 3: Substitutions conservatives III

Résidu d'origine Exemple de substitution

A V L I

R K Q N

N Q H K R

D E

C S

G N

E D

H N Q K R

I L V M A F

L I V M A F

K R Q N

M L F I

F L V I A

P G

S T τ s

w Y

Y W F T S

V I L M F A

Ces variants fonctionnellement conservatifs conservent la capacité de lier la protéine Tau, en particulier la protéine Tau sous forme d'oligomère et éventuellement sous forme de fibres. Préférentiellement ces variants fonctionnellement conservatifs présentent une affinité de liaison avec Tau, en particulier avec Tau sous forme d'oligomère et éventuellement sous forme de fibres, égale ou accrue par rapport au nanocorps correspondant.

Connaissant la séquence d'acides aminés du nanocorps d'intérêt, l'homme du métier est capable de produire les nanocorps selon l'invention, en particulier les nanocorps 2C5 et S2T2M2 E6 définis ci-dessus, par des techniques conventionnelles de production de polypeptides. Par exemple, ils peuvent être synthétisés en utilisant la méthode bien connue de synthèse en phase solide (Merrifield (19962) Proc. Soc. Ex. Boil. 21 :412; Merrifield (1963) J. Am. Chem. Soc. 85:2149; Tarn et al. (1983) J. Am. Chem. Soc. 105:6442), de préférence en utilisant un appareil de synthèse peptidique disponible commercialement (tel que celui fait par Applied Biosystems, Foster City, Californie) et en suivant les instructions du fabricant.

Alternativement, les nanocorps selon l'invention peuvent être synthétisés par des techniques d'ADN recombinant bien connues de l'homme du métier (Maniatis et al. (1982) Molecular Cloning: a laboratory manual, Cold Spring Harbor Laboratories, NY, 51 -54 et 412-430). Par exemple, ils peuvent être obtenus comme produits d'expression d'ADN après incorporation des séquences d'ADN codant le polypeptide d'intérêt dans des vecteurs d'expression et introduction de ces vecteurs dans les hôtes procaryotes ou eucaryotes appropriés qui exprimeront le polypeptide d'intérêt, à partir desquels ils pourront ensuite être isolés en utilisant des techniques bien connues de l'homme du métier. Comme il est bien connu de l'homme du métier, lorsqu'une protéine est synthétisée par des techniques d'ADN recombinant, elle est généralement synthétisée associée à une étiquette facilitant sa purification. De telles étiquettes sont bien connues de l'homme du métier et incluent par exemple l'hexahistidine (6His), la glutathion-S- transférase (GST), étiquette myc ou l'hémagglutinine du virus de la grippe (HA). De préférence, les nanocorps selon l'invention comprennent une étiquette myc et/ou hexahistidine. Par conséquent, un objet de l'invention est également constitué par un nanocorps comprenant ou étant constitué de la séquence d'acides aminés choisie dans le groupe constitué des séquences SEQ ID NO: 9, et SEQ ID NO: 10 comprenant en outre à leur extrémité C-terminale ou N-terminale, de préférence à leur extrémité C-terminale, une étiquette myc et/ou six résidus histidine, de manière plus préférée une étiquette myc et six résidus histidine. Comme il est bien connu de l'homme du métier, lorsqu'une protéine est associée à une étiquette facilitant sa purification, une telle protéine comprend entre la séquence native et cette étiquette une séquence permettant une coupure enzymatique entre la protéine et cette étiquette. Un nanocorps comprenant ou étant constitué de la séquence d'acides aminés choisie dans le groupe constitué des séquences SEQ ID NO: 19 et SEQ ID NO: 20 fait donc également partie de l'invention.

Un autre objet de l'invention concerne un acide nucléique comprenant une séquence nucléique codant le nanocorps selon la présente invention.

Dans un mode de réalisation particulier, l'acide nucléique selon l'invention comprend ou consiste en une séquence nucléique codant un nanocorps défini par l'une des séquences d'acides aminés SEQ ID NO: 9 ou SEQ ID NO: 10. De manière préférée, l'acide nucléique selon l'invention comprend ou consiste en une séquence nucléique codant le nanocorps défini par la séquence d'acides aminés SEQ ID NO: 9.

Typiquement, ledit acide nucléique est une molécule d'ADN ou d'ARN, qui peut être incluse dans n'importe quel vecteur approprié, tel qu'un plasmide, un cosmide, un épisome, un chromosome artificiel, un phage ou un vecteur viral.

Les termes "vecteur", "vecteur de clonage" et "vecteur d'expression" signifient le véhicule par lequel la séquence d'ADN ou d'ARN peut être introduite dans la cellule hôte, de manière à transformer l'hôte et promouvoir l'expression (e.g. transcription et traduction) de la séquence introduite.

Par conséquent, un autre objet de l'invention concerne un vecteur comprenant un acide nucléique selon l'invention.

De tels vecteurs peuvent comprendre des éléments régulateurs, tels qu'un promoteur, un activateur, un terminateur, etc., pour causer ou diriger l'expression du polypeptide. Des exemples de promoteurs et d'activateurs utilisés dans les vecteurs d'expression pour cellule animale incluent le promoteur précoce et l'activateur de SV40 (Mizukami et al. (1987) J. Biochem. 101 :1307-1310), le promoteur LTR et l'activateur de virus de la leucémie de la souris Moloney, le promoteur (Mason et a/ (1985) Ce// 41 :479- 487) et l'activateur (Gillies et al. (1983) Cell 33:717-728) de la chaîne de l'immunoglobuline, etc.

N'importe quel vecteur d'expression pour cellules animales peut être utilisé. Des exemples de vecteurs appropriés incluent pAGE107 (Miyaji et al. (1990) Cytotechnology 3:133-140), pAGE103 (Mizukami et al. (1987) J. Biochem. 101 :1307-1310), pHSG274 (Brady et al. (1984) Gene 27:223-232), pKCR (O'Hare et al. (1981 ) Proc. Natl. Acad. Sci. USA 78:1527-1531 ), pSG1 beta d2-4 (Miyaji et al. (1990) Cytotechnology 3: 133- 140), etc.

D'autres exemples de plasmides incluent des plasmides réplicatifs comprenant une origine de réplication, ou des plasmides intégratifs, tels que par exemple pUC, pcDNA, pBR, etc.

D'autres exemples de vecteurs viraux incluent les vecteurs adénoviraux, rétroviraux, du virus de l'herpès et AAV. De tels virus recombinants peuvent être produits par des techniques bien connues de l'homme du métier, telles que par transfection des cellules d'empaquetage ou par transfection transitoire avec des plasmides ou virus auxiliaires. Des exemples typiques de cellules d'empaquetage de virus incluent les cellules PA317, les cellules PsiCRIP, les cellules GPenv+, les cellules 293, etc. Des protocoles détaillés de production de tels virus recombinants déficients pour leur réplication peuvent être trouvés par exemple dans les demandes WO 95/14785, WO 96/22378, US 5,882,887, US 6,013,516, US 4,861 ,719, US 5,278,056 et WO 94/19478.

Un autre objet de la présente invention concerne une cellule qui a été transfectée, transduite ou transformée avec un acide nucléique et/ou un vecteur selon l'invention.

Le termine "transformation" signifie l'introduction d'un gène ou d'une séquence d'ADN ou d'ARN "étranger" ( e. extrinsèque ou extracellulaire) dans une cellule hôte, de telle sorte que la cellule hôte exprimera le gène ou la séquence introduit pour produire la substance d'intérêt, typiquement une protéine codée par le gène ou la séquence introduit. Une cellule hôte qui reçoit et exprime l'ADN ou l'ARN introduit a été "transformée".

Les acides nucléiques selon l'invention peuvent être utilisés pour produire un nanocorps selon l'invention dans un système d'expression approprié. Le terme "système d'expression" signifie une cellule hôte et un vecteur compatible dans des conditions appropriées, e.g. pour l'expression d'une protéine codée par l'ADN étranger porté par le vecteur et introduit dans la cellule hôte.

Des systèmes d'expression conventionnels incluent les cellules hôtes Escherichia co//' et les vecteurs plasmidiques, les cellules hôtes d'insecte et les vecteurs Baculovirus, et les cellules hôtes de mammifère et leurs vecteurs. D'autres exemples de cellules hôtes incluent les cellules procaryotes (telles que les bactéries), et les cellules eucaryotes (telles que les cellules de levure, les cellules de mammifère, les cellules d'insecte, les cellules de plantes, etc.). Des exemples spécifiques incluent Escherichia coli, les levures Kluyveromyces ou Saccharomyces, les lignées cellulaires de mammifère (e.g. les cellules Vero, les cellules CHO, les cellules 3T3, les cellules COS, etc.) ainsi que les cultures de cellules de mammifères primaires ou établies (e.g. produites à partir de lymphoblastes, fibroblastes, cellules épithéliales, cellules nerveuses, adipocytes, etc.). Des exemples incluent également les cellules SP2/0-Ag14 de souris (ATCC CRU 581 ), les cellules P3X63-Ag8.653 de souris (ATCC CRU 580), les cellules CHO dans lesquelles un gène de la réductase dihydrofolate est défectueux, les cellules YB2/3HL.P2.G1 1 .16Ag.20 de rat (ATCC CRU 662), etc.

La présente invention concerne également une méthode de production d'une cellule hôte recombinante exprimant un nanocorps selon l'invention, ladite méthode comprenant les étapes consistant à :

(i) introduire in vitro ou ex vivo un acide nucléique tel que décrit ci-dessus dans une cellule hôte compétente,

(ii) cultiver in vitro ou ex vivo la cellule hôte recombinante obtenue et

(iii) éventuellement sélectionner les cellules qui expriment et/ou sécrètent ledit nanocorps. De telles cellules hôtes recombinantes peuvent être utilisées pour la production de nanocorps selon l'invention.

Les nanocorps selon l'invention peuvent être produits par n'importe quelle technique connue de l'homme du métier, telles que par exemple n'importe quelle technique chimique, biologique, génétique ou enzymatique, seule ou en combinaison.

En particulier, l'invention concerne en outre une méthode de production d'un nanocorps selon l'invention, ladite méthode comprenant les étapes consistant à:

(i) cultiver une cellule transduite ou transfectée ou transformée selon l'invention dans des conditions appropriées pour permettre l'expression dudit nanocorps, et

(ii) récupérer le nanocorps exprimé.

Les nanocorps selon l'invention peuvent être convenablement séparés du milieu de culture par des procédures de purification d'immunoglobulines conventionnelles, telles que par exemple protéine A-Sépharose, chromatographie hydroxilapatite, électrophorèse sur gel, dialyse ou chromatographie d'affinité.

Nanocorps marqués

Les nanocorps selon l'invention sont particulièrement utiles pour l'imagerie médicale. Dans ce contexte, il est particulièrement intéressant de disposer de nanocorps associés à un marqueur détectable. Les présents inventeurs ont montré que les nanocorps 2C5 et S2T2M3_E6, en particulier 2C5, conservaient leurs propriétés lorsqu'ils étaient associés à un marqueur détectable.

La présente invention concerne donc également un nanocorps tel que défini ci- dessus lié à un marqueur détectable.

Par "nanocorps lié à un marqueur détectable", on entend ici que le marqueur détectable est lié, de manière directe ou indirecte, au nanocorps, par exemple via un peptide de liaison clivable ou non-clivable, ou est incorporé dans le nanocorps. Le marqueur détectable peut en particulier être lié au nanocorps par substitution (par exemple, en substituant un H par un I au niveau des résidus tyrosine), par complexion ou par chélation.

Par "marqueur détectable", on entend ici un composé qui produit un signal détectable. Lorsqu'il est associé à un traceur, il permet de suivre le devenir du traceur dans l'organisme. Le marqueur détectable peut être un agent de contraste IRM, un agent de contraste en scintigraphie, un agent de contraste en imagerie aux rayons X, un agent de contraste ultrason, un agent de contraste en imagerie optique. Des exemples de marqueurs détectables incluent des radioéléments, des fluorophores tels que la fluorescéine, l'Alexa, la cyanine; les composés chimioluminescents tels que le luminol; les composés bioluminescents tels que la luciférase ou la phosphatase alcaline; et les agents de contraste tels que les nanoparticules ou le Gadolinium. Le choix du marqueur détectable approprié, qui dépend du système de détection utilisé, est à la portée de l'homme du métier. A titre d'exemple lorsque le système de détection est l'IRM, le marqueur détectable est de préférence une nanoparticule d'oxyde de fer ou du Gadolinium; lorsque le système de détection est l'imagerie par fluorescence, le marqueur détectable est de préférence la Fluorescéine, l'Alexa ou la cyanine; lorsque le système de détection est l'imagerie par chimioluminescence, le marqueur détectable est de préférence le luminol; lorsque le système de détection est l'imagerie par bioluminescence, le marqueur détectable est de préférence la luciférase ou la phosphatase alcaline; lorsque le système de détection est l'imagerie nucléaire, le marqueur détectable est de préférence un radioélément tel que le Gallium (68Ga) pour l'imagerie TEP, ou le technetium 99m (99mTc) pour l'imagerie SPECT.

De préférence, le marqueur détectable est un radioélément. Des exemples de radioéléments, qui sont plus particulièrement utilisés dans les techniques d'imagerie nucléaires, incluent le Technetium 99m (99mTc), l'iode 123 (123l), l'iode 125 (125l), , le fluor 18 (18F), le gallium 68 (68Ga), et n'importe quel autre radioélément utilisable chez les êtres humains. Par conséquent, de préférence, le radioélément est choisi dans le groupe constitué du 99mTc, 123l, 125l, 18F, et 68Ga. De manière préférée entre toutes, le radioélément est le 99mTc ou 68Ga, de manière encore préférée 99mTc.

Utilisation comme agent de contraste

Les inventeurs ont démontré que le nanocorps 2C5 permet un marquage spécifique des corps cellulaires de l'hippocampe, du cortex entorhinal et du cortex temporal chez des patients atteints de la maladie d'Alzheimer et dans une tauopathie pure. Les inventeurs ont donc démontré que les nanocorps de l'invention, en particulier 2C5, constituaient des traceurs spécifiques des formes pathologiques de la protéine Tau, en particulier des formes pathologiques précoces de Tau, par exemple Tau sous forme d'oligomère et éventuellement sous forme de fibres, et permettent sa détection par imagerie.

L'invention propose donc un nanocorps tel que défini ci-dessus pour son utilisation comme agent de contraste dans l'imagerie médicale, en particulier l'imagerie médicale in vivo, non invasive.

Elle concerne également l'utilisation d'un nanocorps tel que défini ci-dessus pour la fabrication d'un agent de contraste utile pour l'imagerie médicale, en particulier l'imagerie médicale in vivo, non invasive.

Par "agent de contraste", on entend ici une substance ou une composition qui, administrée dans l'organisme, permet de marquer de manière détectable des organes ou des structures (tissu, cellule, récepteur) qui, sans agent de contraste, sont peu ou non visibles en imagerie médicale. Par extension, l'expression "agent de contraste" est utilisée pour désigner un traceur associé à un marqueur tel que défini ci-dessus.

Dans le contexte de l'invention, les "méthodes d'imagerie" se réfèrent à des méthodes qui permettent de visualiser l'intérieur d'un organisme ou des organes d'un organisme. Des exemples de méthodes d'imagerie incluent des techniques invasives telles que l'échographie endocoronaire, et des techniques non-invasives telles que l'imagerie par résonnance magnétique, l'imagerie aux rayons X, l'échographie, l'imagerie optique, ou la médecine nucléaire telle que la scintigraphie, en particulier la tomographie d'émission monophotonique (SPECT) et la tomographie d'émission de positons (PET). De préférence, la méthode d'imagerie selon l'invention est la scintigraphie, en particulier la scintigraphie SPECT ou PET.

La scintigraphie repose sur l'administration (généralement par voie intraveineuse) d'un agent de contraste, aussi appelé radio-pharmaceutique, constitué d'un traceur marqué par un radioélément. La localisation spécifique de cet agent de contraste dans l'organisme est ensuite déterminée par détection des rayons gamma ou bêta émis.

La tomographie d'émission monophotonique et la tomographie d'émission de positons sont des techniques d'imagerie médicale nucléaire tomographique basées sur la scintigraphie et qui permettent de réaliser des images et des reconstructions en trois dimensions des organes et de leur métabolisme au moyen d'un ensemble de caméras qui tournent autour du patient.

La présente invention concerne également une méthode d'imagerie médicale, en particulier d'imagerie médicale in vivo, non invasive, dans laquelle un nanocorps tel que défini ci-dessus est administré à un patient. La méthode d'imagerie médicale selon l'invention peut en outre comprendre les étapes de détection de la liaison ou de l'absence de liaison du nanocorps dans des zones corporelles du patient et de visualisation des zones corporelles du patient dans lesquelles la liaison du nanocorps peut être détectée.

Dans le contexte de l'invention, un "patient" désigne un mammifère humain ou non-humain, tel qu'un rongeur (rat, souris, lapin), un primate (chimpanzé), un félin (chat), un canin (chien). De préférence, l'individu est humain.

Dans un mode de réalisation particulier, le terme « patient » désigne un humain qui présente des symptômes associés à une tauopathie. Selon la tauopathie, ces symptômes peuvent être par exemple le syndrome de parkinson, la dystonie axiale, le phénomène de main capricieuse, ou des troubles cognitifs du patient.

N'importe quelle méthode d'administration, connue de l'homme du métier, peut être utilisée pour administrer le nanocorps selon l'invention au patient. En particulier, le nanocorps peut être administré par exemple par voie orale, par inhalation or par voie parentérale (en particulier par injection intraveineuse). Quand la voie parentérale est choisie, le nanocorps peut être sous forme de solutions et de suspensions injectables, conditionné en ampoules ou flacons. Les formes d'administration parentérale sont conventionnellement obtenues par mélange du nanocorps selon l'invention avec des tampons, stabilisants, conservateurs, agents solubilisants, agents isotoniques et agents de mise en suspension. Selon des techniques connues, ces mélanges peuvent être stérilisés et conditionnés sous la forme d'injections intraveineuses. L'homme du métier peut par exemple utiliser des tampons à base de sels de phosphate en tant que tampons. Des exemples d'agents de mise en suspension incluent la méthylcellulose, l'acacia, et la carbocyméthylcellulose de sodium. Des exemples de stabilisants incluent le sulfite de sodium et le métasulfite de sodium, et des exemples de conservateurs incluent le p- hydroxybenzoate de sodium, l'acide sorbique, le crésol et le chlorocrésol.

La quantité de nanocorps administrée dépend naturellement de la voie d'administration, de la taille et/ou du poids du patient, et de la technique de détection utilisée.

Dans le contexte de l'invention, le terme "zone corporelle" fait référence à une région déterminée de l'organisme. Il peut s'agir par exemple d'un organe, d'une partie d'un organe ou d'un tissu, tel que le cerveau, en particulier l'hippocampe, le cortex entorhinal ou le cortex temporal.

Dans un mode de réalisation particulier, le nanocorps selon l'invention est utilisé comme agent de contraste dans l'imagerie médicale pour visualiser la protéine Tau sous forme pathologique, en particulier, pour visualiser Tau sous forme choisie parmi les oligomères, les fibres, les paires hélicoïdales de filaments et les filaments droit, de préférence les oligomères et les fibres, de manière encore préférée les oligomères, chez un patient.

Dans un mode de réalisation, le nanocorps selon l'invention est utilisé comme agent de contraste dans l'imagerie médicale pour visualiser les dégénérescences neurofibrillaires (DNFs) chez un patient.

Dans un exemple, la distribution corticale et le nombre des, par exemple, DNFs sont corrélés avec les troubles mnésiques chez le patient atteint par exemple de MA.

Utilisation diagnostique

L'apparition des formes pathologiques de la protéine Tau, telles que définies ci- dessus, est un marqueur d'une tauopathie. En outre, la détection des formes pathologiques de Tau, en particulier des formes pathologiques précoces, telles que la protéine Tau sous formes d'oligomères et éventuellement de fibres, permet d'identifier la présence des formes toxiques impliquées dans la propagation ou le développement d'une des tauopathies. L'identification des formes pathologiques, en particulier des formes pathologiques précoces, telles que Tau sous forme d'oligomères et éventuellement de fibres, constitue donc la caractérisation d'une tauopathie et/ou l'identification du début d'une tauopathie. D'autre part, la possibilité de suivre par imagerie l'évolution, c'est-à-dire la progression ou la régression, d'une forme pathologique de Tau précédemment identifiée représente une modalité pour évaluer l'efficacité d'un traitement thérapeutique chez un patient chez qui on a diagnostiqué une tauopathie.

L'invention concerne donc également un nanocorps tel que défini ci-dessus pour son utilisation dans des méthodes de diagnostic ou de pronostic.

Par "méthode diagnostique" ou "diagnostic", on entend ici une méthode permettant de déterminer si un individu souffre d'une pathologie.

Par "méthode pronostigue" ou "pronostic", on entend ici une méthode permettant de déterminer si un individu risque de développer une pathologie.

De préférence, le nanocorps tel que défini ci-dessus est utilisé pour le diagnostic ou le pronostic d'une tauopathie.

Les tauopathies sont telles que définies ci-dessus. De préférence, le nanocorps selon l'invention est utilisé pour le diagnostic ou le pronostic de la maladie d'Alzheimer.

La présence, par exemple, de Tau sous forme d'oligomère expose le sujet à un risque de développer une tauopathie, notamment la maladie d'Alzheimer. Le nanocorps selon l'invention peut donc être utilisé pour détecter un risque de survenue d'une tauopathie, en particulier une maladie d'Alzheimer, chez un patient. Par "risque de survenue", on entend ici la probabilité qu'un individu développe une pathologie.

La présente invention concerne également une méthode de diagnostic d'une tauopathie et/ou de détection d'un risque de survenue d'une tauopathie chez un patient, ladite méthode comprenant les étapes consistant à administrer un nanocorps tel que défini ci-dessus audit patient et à détecter ledit nanocorps dans l'organisme dudit patient, la détection d'une localisation préférentielle dudit nanocorps au niveau du cerveau étant indicatrice d'une tauopathie et/ou d'un risque de survenue d'une tauopathie.

Dans un mode de réalisation, ladite méthode comprend en outre les étapes consistant à administrer un marqueur de plaques amyloïdes audit patient et à détecter ledit marqueur de plaques amyloïdes dans l'organisme dudit patient, la détection d'une localisation préférentielle dudit nanocorps et dudit marqueur de plaques amyloïdes au niveau du cerveau étant indicatrice d'une tauopathie et/ou d'un risque de survenue d'une tauopathie, en particulier de la maladie d'Alzheimer.

En conséquence, la présente invention concerne également une méthodede diagnostic d'une tauopathie, en particulier la maladie d'Alzheimer et/ou de détection d'un risque de survenue d'une tauopathie, en particulier de la maladie d'Alzheimer, chez un patient, ladite méthode comprenant les étapes consistant à :

i) administrer un nanocorps selon l'invention audit patient et à détecter ledit nanocorps dans l'organisme dudit patient, et

ii) administrer un marqueur de plaques amyloïdes audit patient et à détecter ledit marqueur de plaques amyloïdes dans l'organisme dudit patient,

la détection d'une localisation préférentielle dudit nanocorps et dudit marqueur de plaques amyloïdes au niveau du cerveau étant indicatrice d'une tauopathie, en particulier de la maladie d'Alzheimer et/ou d'un risque de survenue d'une tauopathie, en particulier de la maladie d'Alzheimer.

Dans une mode de réalisation ces méthodes de diagnostic d'une tauopathie sont des méthodes in vivo.

Par "marqueur de plaques amyloïdes" on entend des traceurs liés à un marqueur détectable qui se lie d'une façon spécifique aux plaques amyloïdes et qui sont utilisables comme agent de contraste dans l'imagerie médicale in vivo, non invasive. Des marqueurs de plaques amyloïdes sont par exemple des traceurs 18F telle que 18F-florbetapir, 18F- florbetaben, 18F-flutemetanol et 18F-AZD4694-marque.

Il est décrit dans l'art antérieur et il est donc connu de l'homme du métier, selon les tauopathies particulières, quelle région cérébrale est affecté par la présence des formes pathologiques de Tau. La localisation dans le cerveau des dégénérescences neurofibrillaires ou d'autres forme pathologiques de Tau et éventuellement des plaques amyloides est décrite pour plusieurs tauopathies, par exemple dans Catafau, AM et Bullich, S (Clin Transi Imaging. 2015;3(1 ):39-55. Epub 2015 Jan 21 .) ou dans Tranchant, C. (médicine/sciences A1997 ; 13 : 989-97).

Par "localisation préférentielle", on entend que la quantité de nanocorps détectée au niveau du cerveau, en particulier par exemple aux niveaux des corps cellulaires de l'hippocampe, néocortex frontal, du cortex entorhinal et du cortex temporal est supérieure au bruit de fond qui correspond à une localisation non spécifique du nanocorps dans l'organisme.

Par exemple, la paralyse supranucléaire progressive est caractérisée par la présence de DNF au niveau du tronc cérébral et du néocortex frontal.

Dans un autre exemple, la dégénérescence corticobasale est caractérisée par la présence de DNF au niveau du cortex pariétal.

Dans un autre exemple, la maladie d'Alzheimer est caractérisée par la présence de DNF au niveau des structures enthorino-corticales.

L'invention concerne également le nanocorps selon l'invention pour son utilisation pour le suivi thérapeutique d'une tauopathie chez un sujet chez qui une tauopathie a été diagnostiquée.

Elle concerne aussi l'utilisation du nanocorps selon l'invention pour la fabrication d'un agent de contraste utile pour le suivi thérapeutique d'une tauopathie chez un sujet chez qui une tauopathie a été diagnostiquée.

Par "suivi thérapeutique" on entend ici l'observation de la réponse du sujet au traitement qui lui est administré. L'effet thérapeutique d'un traitement est généralement associé à un ralentissement ou une inhibition de la progression d'une maladie, à une réversion de la maladie, ou d'un ou plusieurs symptômes associés à cette maladie. Inversement, une absence d'effet thérapeutique peut se traduire par une stabilité, voire une accélération, de la progression de la maladie ou d'un ou plusieurs de ses symptômes. Par exemple si une tauopathie a été diagnostiquée à cause de la présence des formes pathologiques de Tau, le suivi thérapeutique peut être réalisé en observant la disparition, la régression, le maintien, ou la croissance des formes pathologiques de Tau. Ainsi l'utilisation selon l'invention peut comprendre les étapes consistant à :

a) administrer un nanocorps tel que défini ci-dessus à un sujet chez qui on a détecté une forme pathologique de Tau;

b) détecter la liaison du nanocorps au niveau de ladite forme pathologique de Tau; c) répéter les étapes a) et b) avant et après administration d'un traitement audit sujet ; une absence ou une diminution de la liaison du nanocorps au niveau de ladite forme pathologique de Tau étant indicatrice d'un traitement ayant un effet thérapeutique.

La « forme pathologique de Tau » est telle que défini dans la section « tauopathie » ci-dessus.

De préférence le traitement est un traitement d'une taupopathie et comprend par exemple l'utilisation d'inhibiteurs de l'agrégation de Tau. Dans un autre exemple, le traitement d'une taupopathie comprend l'utilisation des nanobodies de l'invention.

Utilisation comme médicament

Récemment, il a été montré que les formes pathologiques de Tau, par exemple, des formes toxiques extracellulaires, représentaient les formes toxiques de Tau (Usenovic et al., 2015) impliquées dans la propagation (Goedert et al., 2014) des tauopathies telles que la MA au sein du cerveau, par contamination de proche en proche des neurones. En conséquence, cibler les formes toxiques de Tau pour inhiber leur agrégation et donc la formation des paires de filaments appariés en hélice (PHFs) et des filaments droits (SFs) est un traitement prometteur des tauopathies, en particulier de la maladie d'Alzheimer.

En conséquence, l'invention concerne en outre l'utilisation d'un nanocorps tel que défini ci-dessus pour la fabrication d'un médicament, en particulier un médicament destiné au traitement d'une tauopathie. Une méthode de traitement comprenant l'administration d'une quantité thérapeutiquement efficace du nanocorps tel que défini ci-dessus à un patient en ayant besoin, fait également partie de la présente invention.

L'utilisation d'un nanocorps anti- Tau permet donc d'inhiber l'avancement de l'agrégation de Tau.

Par "traitement" d'une tauopathie on entend le "traitement thérapeutique" (ou curatif) d'une tauopathie, qui inclut le ralentissement ou l'inhibition de l'évolution d'une tauopathie. On entend également le "traitement prophylactique" d'une tauopathie qui inclut notamment la prévention des formations des DNF.

Par « prévention », on entend le fait de d'empêcher ou de retarder la survenue ou de diminuer l'intensité des manifestations cliniques ou biochimiques associées à la tauopathie.

L'homme du métier sait, de par ses connaissances générales, déterminer quelles sont les manifestations cliniques ou biochimiques associées à une tauopathie donnée et qui sont susceptibles d'être améliorées (traitement) ou bien empêchées, retardées ou diminuées en intensité (prévention). Dans le cadre des tauopathies, un paramètre biologique d'intérêt peut-être la présence et la localisation de Tau sous forme pathologique, en particulier Tau sous forme pathologique précoce, telle que la protéine Tau sous forme d'oligomères et éventuellement Tau sous forme de fibres. L'invention concerne plus particulièrement le nanocorps tel que défini ci-dessus pour son utilisation pour le traitement d'une tauopathie et/ou à la prévention d'une tauopathie, de préférence pour le traitement et/ou la prévention de la maladie d'Alzheimer.

L'invention concerne également l'utilisation d'un nanocorps tel que défini ci-dessus pour la fabrication d'un médicament destiné au traitement d'une tauopathie et/ou à la prévention d'une tauopathie chez un patient susceptible de présenter une tauopathie.

L'invention concerne également une méthode de traitement d'une tauopathie et/ou de prévention d'une tauopathie chez un patient en ayant besoin, comprenant l'administration d'une quantité thérapeutiquement efficace d'un nanocorps tel que défini ci- dessus à un patient en ayant besoin.

Préférentiellement, le nanocorps selon l'invention est utilisé pour traiter les formes pathologiques de Tau, en particulier les formes pathologiques précoces, tel que les formes d'oligomères de Tau et éventuellement les formes de fibres de Tau.

Le nanocorps selon l'invention peut être administré par exemple par voie orale, par inhalation, par voie parentérale (en particulier par injection intraveineuse), sous une forme appropriée. Lorsque la voie parentérale est envisagée, le nanocorps peut être sous la forme de solutés et suspensions injectables conditionnées en ampoules ou flacons. Les formes pour l'administration parentérale sont obtenues de façon conventionnelle par mélange du nanocorps avec des tampons, des agents stabilisants, des conservateurs, des agents solubilisants, des agents isotoniques et des agents de mise en suspension. Conformément aux techniques connues, ces mélanges sont ensuite stérilisés puis conditionnés sous la forme d'injections intraveineuses. A titre de tampon, l'homme du métier pourra utiliser des tampons à base de sels de phosphate organique. Des exemples d'agents de mise en suspension englobent la méthylcellulose, l'hydroxyéthylcellulose, l'hydroxy-propylcellulose, l'acacia et la carboxyméthylcellulose sodique. En outre, des stabilisants utiles selon l'invention sont le sulfite de sodium et le métasulfite de sodium, tandis que l'on peut citer le p-hydroxybenzoate de sodium, l'acide sorbique, le crésol et le chlorocrésol en tant que conservateurs.

La quantité de nanocorps administrée dépend naturellement du mode d'administration, de la taille et/ou du poids du patient, et de la nature de l'agent cytotoxique qui peut lui être associé.

La présente invention concerne également une composition pharmaceutique comprenant un nanocorps tel que défini ci-dessus en association avec un véhicule pharmaceutiquement acceptable. Le terme "pharmaceutiquement" ou "pharmaceutiquement acceptable" se réfère à des entités moléculaires et compositions qui ne produisent pas de réactions secondaires, allergiques ou autrement fâcheuses lorsqu'elles sont administrées à un mammifère, en particulier un humain.

Dans le contexte de l'invention, l'expression "véhicule pharmaceutiquement acceptable" inclut n'importe quel solvant, milieu de dispersion, revêtement, agent antibactérien ou antifongique, agent isotonique ou retardant l'absorption, et analogues. L'utilisation de tels milieux et agents pour les substances pharmaceutiquement actives est bien connue de l'homme du métier. A l'exception du cas où un milieu ou agent conventionnel est incompatible avec l'ingrédient actif, son utilisation dans les compositions pharmaceutiques est envisagée. Des ingrédients actifs supplémentaires peuvent également être incorporés dans les compositions.

Utilisation pour détecter in vitro Tau

La présente invention concerne également l'utilisation d'un nanocorps tel que défini ci- dessus pour la détection in vitro de la protéine Tau sous forme d'oligomères dans un échantillon.

Par "échantillon", on entend ici une partie d'un élément plus grand. De préférence, l'échantillon est une substance d'origine biologique. Des exemples d'échantillons biologiques incluent, mais ne sont pas limités à, des parties d'organes ou de tissus tels que tel que le cerveau, en particulier l'hippocampe, le cortex entorhinal ou cortex temporal, le sang, en particulier le sang cérébral, le liquide céphalo-rachidien. De préférence un échantillon dans le contexte de l'invention concerne un échantillon de cerveau. La présente invention sera illustrée plus en détail par les figures, les séquences et l'exemple ci-dessous.

BRÈVE DESCRIPTION DES SÉQUENCES

SEQ ID NO: 1 montre la séquence d'acides aminés consensus de CDR1 des nanocorps de l'invention dans laquelle l'acide aminé Xi est S ou R, X2 est D ou Y et X3 est T ou A .

SEQ ID NO: 2 montre la séquence d'acides aminés consensus de CDR2 des nanocorps de l'invention dans laquelle l'acide aminé Xi est P ou R et X2 est S ou V.

SEQ ID NO: 3 montre la séquence d'acides aminés de CDR1 du nanocorps 2C5.

SEQ ID NO: 4 montre la séquence d'acides aminés de CDR2 du nanocorps 2C5.

SEQ ID NO: 5 montre la séquence d'acides aminés de CDR3 du nanocorps 2C5. SEQ ID NO: 6 montre la séquence d'acides aminés de CDR1 du nanocorps S2T2M3_E6. SEQ ID NO: 7 montre la séquence d'acides aminés de CDR2 du nanocorps S2T2M3_E6. SEQ ID NO: 8 montre la séquence d'acides aminés de CDR3 du nanocorps S2T2M3_E6. SEQ ID NO: 9 montre la séquence d'acides aminés de la région variable du nanocorps 2C5.

SEQ ID NO: 10 montre la séquence d'acides aminés de la région variable du nanocorps S2T2M3_E6.

SEQ ID NO: 11 montre la séquence d'acides aminés de la région FR1 du nanocorps 2C5. SEQ ID NO: 12 montre la séquence d'acides aminés de la région FR2 du nanocorps 2C5. SEQ ID NO: 13 montre la séquence d'acides aminés de la région FR3 du nanocorps 2C5. SEQ ID NO: 14 montre la séquence d'acides aminés de la région FR4 du nanocorps 2C5. SEQ ID NO: 15 montre la séquence d'acides aminés de la région FR1 du nanocorps S2T2M2_E6.

SEQ ID NO: 16 montre la séquence d'acides aminés de la région FR2 du nanocorps S2T2M2_E6.

SEQ ID NO: 17 montre la séquence d'acides aminés de la région FR3 du nanocorps S2T2M2_E6.

SEQ ID NO: 18 montre la séquence d'acides aminés de la région FR4 du nanocorps S2T2M2_E6

SEQ ID NO: 19 montre la séquence d'acides aminés de la région variable du nanocorps 2C5 avec une étiquette myc et six résidus histidine.

SEQ ID NO: 20 montre la séquence d'acides aminés de la région variable du nanocorps S2T2M3_E6 avec une une étiquette myc et six résidus histidine.

SEQ ID NO: 21 montre la séquence d'acides aminés de l'isoforme 2N4R de la protéine Tau, également appelée Tau-F, avec 441 acides aminés.

SEQ ID NO: 22 montre la séquence d'acides aminés de l'isoforme 1 N4R de la protéine Tau, également appelée Tau-E, avec 412 acides aminés.

SEQ ID NO: 23 montre la séquence d'acides aminés de l'isoforme 0N4R de la protéine Tau, également appelée Tau-D, avec 383 acides aminés.

SEQ ID NO: 24 montre la séquence d'acides aminés de la isoforme 2N3R de la protéine Tau, également appelée Tau-C, avec 410 acides aminés.

SEQ ID NO: 25 montre la séquence d'acides aminés de l'isoforme 1 N3R de la protéine Tau, également appelée Tau-B, avec 381 acides aminés.

SEQ ID NO: 26 montre la séquence d'acides aminés de l'isoforme 0N3R de la protéine Tau, également appelée Fetal-Tau, avec 352 acides aminés. SEQ ID NO: 27 montre la séquence d'acides aminés de la protéine Tau tronquée consistant en la région3R de la protéine Tau.

DESCRIPTION DES FIGURES Figure 1 : Graphique qui montre les résultats des tests ELISA et donc des courbes d'affinité du nanocorps 2C5 pour Tau-0 (Tau oligomères), Tau-F (tau fibres), Mimes (la région R3 de Tau polymérisé) et Tau-N (tau natives).

Figure 2 : Graphique qui montre l'absence d'affinité pour le peptide amyloïde Abeta1 -42 polymérisé

Figure 3 : Immunohistochimie comparative sur des coupes de cortex temporal d'un cas de MA ; A) AT8 est un: anticorps monoclonal dirigé contre les PHF phosphorylé en Ser202 et Thr 205 ; B) 2C5 est le nanocorps de l'invention dirigé contre Tau sous forme d'oligomères C) T22 est un anticorps monoclonal dirigé contre les oligomères de tau, D) Ab4G8 est un anticorps monoclonal dirigé contre les formes agrégées de peptide beta amyloïde).

Figure 4 : Alignement des séquences variables des nanocorps de l'invention. Figure 5 : Graphique qui montre les résultats des tests ELISA et donc des courbes d'affinité du nanocorps 2C5 (sans radiomarquage) pour des polymères de la séquence R3 de la protéine tau.

Figure 6 : Graphique qui montre les résultats des tests ELISA et donc des courbes d'affinité du nanocorps 2C5 (radiomarqué à iode 125) pour des polymères de la séquence R3 de la protéine tau.

EXAMPLE

1) Génération des nanobodies :

(1 ) Préparation des antigènes nécessaires à l'immunisation des camélidés :

L'ADNc (htau40) codant pour l'isoforme la plus longue de Tau (441 aa - 45,8 kDa) a été cloné dans un plasmide pRK172, en aval du promoteur de l'ARN polymérase T7. Les plasmides recombinants ont été transformés dans des bactéries Escherichia coli BL21 (procurées auprès de Goedert, M et al., Neuron, 3(4): 519-526 (1989))(bactéries fournies par l'équipe du Pr Baulieu, INSERM, Paris). La purification de la protéine est réalisée par deux étapes de FPLC (Fast Protein Liquid Chromatography) : (1 ) par colonne à échange de cations chargée en S04- (HiTrap SP-XL, Thermoscientfic) puis (2) par chromatographie d'exclusion (Colonne Hi Trap Sepharose HP - Amersham Biosciences). Pour obtenir des préparations enrichies avec différentes formes polymérisées de tau (oligomère et fibres) mimant la fibrillation de Tau in vivo, nous avons utilisé la méthode de Haase et al. (Journal of Neurochemistry, 88(6): 1509-1520, 2004) modifiée par Flach et al. (Journal of Biological Chemistry, 2012, (287) 52: 43223-43233). La fibrillation de Tau (40 μΜ) est réalisée à 37°C dans du tampon MOPS (acide 3-(N-morpholino) propane sulfonique) 20 mM, pH 7 en présence d'héparine (10 μΜ) de NaN3 (4%) pour un volume final de 1 ,5 mL [21 ] [14]. La fibrillation est analysée comme décrit ci-dessus. La fibrillation est stoppée par congélation des échantillons à -80°C au bout de 48 heures et de 72h. La durée du processus de polymérisation est adaptée à la production (a) d'oligomères et (b) de fibres. En parallèle, un peptide recouvrant la région R3 des motifs répétés de Tau a été synthétisé et polymérisé de manière similaire. En particulier, la fibrillation de R3 (0.4 μΜ) est réalisée à 37°C dans du tampon PBS (phosphate buffer saline 50 mM, à pH 7 en présence d'héparine (0.4 μΜ), de NaN3 (4%) pour un volume final de 1 ,5 ml. La fibrillation est stoppée par congélation des échantillons à -80°C au bout de typiquement 72 heures pour obtenir Tau tronquée (R3) sous forme de fibres.

(2) Immunisation des lamas :

Un lama a été immunisé dans les mêmes conditions avec un mélange constitué d'oligomères et de fibres de Tau ainsi que de polymères de R3 ((a), (b) (c)). Trois injections successive sont réalisés en jours 0, 9, 18. Les prélèvements de sang sont réalisés en jour 28 et 42. Les poches de sang sont centrifugées en gradient de Ficoll afin de séparer et isoler les lymphocytes et les ARN totaux sont extraits.

(3) Production et criblage des nanobodies : Ils comportent plusieurs étapes :

- Amplification et production des mRNA des lymphocytes du lama

- Génération d'une librairie de phages exprimant les nanobodies du dromadaire précédemment immunisé.

- Sélection, par des tests ELISA et par FACS, de phages exprimant des nanobodies anti-tau-oligomères.

- Séquençage des clones sélectionnés et identification de clones distincts

- Détermination des séquences du Nbs, - construction et production du fragment d'ARNm codant pour un Nb comportant un tag Myc et histidine en Cterm

- Insertion en bactéries et production en quantité du Nb.

2. Caractérisation in vitro des nanobodies :

Les nanobodies ont été caractérisés pour leur affinité et leur spécificité au travers de deux étapes.

a) Tests ELISA I : avec les antigènes de départ soit préparation enrichie en tau oligomères, préparation enrichie en tau fibres, R3 polymérisé, ainsi que la protéine tau native et des fibres de peptide beta amyloïde (réalisé à partir de peptide du commerce). Les constantes d'affinités des nanobodies ont été déterminées pour chacun de ces immunogènes. b) Immunohistochimie : sur des coupes de tissus en paraffine provenant de l'anatomo- pathologie humaine (collaboration avec le Département de Santé Mentale et de Psychiatrie à Genève). Ces coupes recouvrent différents cas de tauopathies plus ou moins sévères,

c)

Les coupes de tissu sont déparaffiné puis traitées en coupes flottantes après perméabilisation en tampon PBS-Triton 0.2 % et démasquage de l'antigène au moyen d'une solution de démasquage du commerce (Vector H-3300). L'anticorps primaire (Nb) est appliqué à différentes concentrations (≥ 20 nM) toute la nuit à 4°C. Après rinçage un anticorps anti-histdine de lapin est appliqué pendant 1 h à température ambiante puis un troisième anticorps anti lapin de chèvre pendant 1 h est enfin appliqué près rinçage. La révélation est réalisée au travers de deux étapes incubation en présence de complexe avidine biotine (kit ABC Vector) puis di-amino-benzidine(kit ABC Vector). Des coupes contrôles sont systématiquement réalisées en absence du premier anticorps (Nb). Les coupes sont montées sur lame et contre colorées au moyen de l'hématoxiline. d) Tests ELISA II : Le nanobody 2C5 a été radiomarqué à iode 125. Les test d'affinité pour des polymères de la séquence R3 de la protéine tau, sont réalisés en ELISA , dans un tampon Phosphate Buffer Saline (NaCI, 137mM ; KCI, 2.7mM ; Na2HP04, 10mM KH2P04, 1 .8mM) BSA 1 % ; pH = 7.5 . Les ELISAs sont réalisés avant (Figure 5) et après radiomarquage (Figure 6). On constate qu'après radiomarquage, le ligand conserve une bonne affinité pour sa cible (Figure 6). 3. Résultats :

Nous avons produit plusieurs anticorps de camélidé à domaine variable unique (Nbs), dirigés spécifiquement contre des formes pathologiques précoces de la protéine Tau (oligomères et fibres) de faible poids moléculaires (15 kDa) : 2Ç5 (VHH), S2T2M3 E6 (VHH).

Le Nb 2C5 a été séquencé et caractérisé comme VHH et caractérisé in vitro. Il présente des affinités respectives (Kd) de 5nM, 6 nM et 50 nM pour les oligomères, les fibres et des formes tronquées polymérisées de Tau. Ce Nb ne se lie ni à la protéine tau native (Kd>1800 nM) ni aux fibres de peptide beta amyloïde (Kd>10 000 nM). (Figue 1 et 2). Ce Nb a été testé en immunohistochimie sur des coupes de cerveaux humains provenant de l'anatomopathologie (Alzheimer de différents grade et tauopathie). Il démontre un marquage spécifique des corps cellulaires de l'hippocampe, du cortex entorhinal et du cortex temporal chez des patients atteint de la maladie d'Alzheimer et dans un cas de démence avec tauopathie pure (Tableau 4, Figure 3).

Le radiomarquage au technétium 99m de ce SdAbs a été réalisé avec succès.

Le Nb S2T2M3 E6 a été sélectionné pour son affinité aux polymères de tau de bas poids moléculaires.

Tableau 4: Cas d'anatomo-pathologie humaine testés pour 2C5

Type Abbréviation Stade de

Age Sexe CDR MMS pathologie type Break

Vieillissement

C ? ? 1 ? ? normal

AD AD ? ? 5 ? ?

AD AD 74 F 5 na 15/30

AD AD 81 F 5 na 17/30

Tangle only

T 73 M 4 na na dementia

PSP/CBD PSP/CBD ? ? Non ? ?

Revendications

1. Nanocorps dirigé contre la protéine Tau, ladite protéine Tau étant sous forme d'oligomères et ledit nanocorps étant dépourvu de chaîne légère.

2. Nanocorps selon la revendication 1 , ledit nanocorps entre en compétition pour la liaison à la protéine Tau sous forme d'oligomères avec un nanocorps comprenant les séquences d'acides aminés

(i) GRTFSXiX2X3 (SEQ ID NO: 1 ) comme CDR1 dans laquelle l'acide aminé ΧΊ est S ou R, X2 est D ou Y et X3 est T ou A,

(ii) ISX1SGGX2T (SEQ ID NO: 2) comme CDR2 dans laquelle l'acide aminé ΧΊ est P ou R et X2 est S ou V, et

(iii) NRDPKYGNTRY (SEQ ID NO: 5) ou TARRRISGTPQWHY (SEQ ID NO: 8) comme CDR3.

3. Nanocorps selon la revendication 1 ou 2, ledit nanocorps entre en compétition pour la liaison à la protéine Tau sous forme d'oligomères avec un nanocorps choisi parmi un nanocorps comprenant :

a) les séquences d'acides aminés (i) GRTFSSDT (SEQ ID NO: 3) comme CDR1 , (ii) ISPSGGVT (SEQ ID NO: 4) comme CDR2 et (iii) NRDPKYGNTRY (SEQ ID NO: 5) comme CDR3 ; ou

b) les séquences d'acides aminés (i) GRTFSRYA (SEQ ID NO: 6) comme CDR1 , (ii) ISRSGGST (SEQ ID NO: 7) comme CDR2 et (iii) TARRRISGTPQWHY (SEQ ID NO: 8) comme CDR3.

4. Nanocorps selon l'une quelconque des revendications 1 à 3, ledit nanocorps comprenant les séquences d'acides aminés

(i) GRTFSX1X2X3 (SEQ ID NO: 1 ) comme CDR1 dans laquelle l'acide aminé ΧΊ est S ou R, X2 est D ou Y et X3 est T ou A,

(ii) ISX1SGGX2T (SEQ ID NO: 2) comme CDR2 dans laquelle l'acide aminé ΧΊ est P ou R et X2 est S ou V, et

(iii) NRDPKYGNTRY (SEQ ID NO: 5) ou TARRRISGTPQWHY (SEQ ID NO: 8) comme CDR3. 5. Nanocorps selon l'une quelconque des revendications 1 à 4, ledit nanocorps comprenant : a) les séquences d'acides aminés (i) GRTFSSDT (SEQ ID NO: 3) comme CDR1 , (ii) ISPSGGVT (SEQ ID NO: 4) comme CDR2 et (iii) NRDPKYGNTRY (SEQ ID NO: 5) comme CDR3 ; ou

b) les séquences d'acides aminés (i) GRTFSRYA (SEQ ID NO: 6) comme CDR1 , (ii) ISRSGGST (SEQ ID NO: 7) comme CDR2 et (iii) TARRRISGTPQWHY (SEQ ID NO:

8) comme CDR3 ; ou

un variant fonctionnellement conservatif du nanocorps défini en a) ou b) comprenant une substitution conservative d'un ou deux acides aminés dans respectivement une, deux ou trois des séquences SEQ ID NO: 3, SEQ ID NO: 4 et SEQ ID NO: 5, ou SEQ ID NO: 6, SEQ ID NO: 7 et SEQ ID NO: 8.

6. Nanocorps selon l'une quelconque des revendications 1 à 5, ledit nanocorps comprenant une séquence d'acides aminés sélectionnée dans le groupe consistant en les séquences d'acides aminés SEQ ID NO: 9 ou SEQ ID NO: 10, de préférence SEQ ID NO: 9.

7. Nanocorps selon l'une quelconque des revendications 1 à 6, ledit nanocorps étant liée à un marqueur détectable. 8. Nanocorps selon la revendication 7, ledit marqueur détectable étant un radioélément.

9. Nanocorps selon l'une quelconque des revendications 1 à 8 pour son utilisation comme agent de contraste dans l'imagerie médicale in vivo, non invasive.

10. Nanocorps selon l'une quelconque des revendications 1 à 9, pour son utilisation dans des méthodes de diagnostic ou de pronostic, de préférence d'une Tauopathies.

11. Nanocorps selon l'une quelconque des revendications 1 à 6 pour son utilisation comme médicament.

12. Utilisation d'un nanocorps tel que défini dans l'une quelconque des revendications 1 à 6 pour la détection in vitro de la protéine Tau sous forme d'oligomères dans un échantillon.

13. Composition pharmaceutique comprenant un nanocorps tel que défini dans l'une quelconque des revendications 1 à 6 en association avec un véhicule pharmaceutiquement acceptable. 14. Acide nucléique comprenant une séquence nucléique codant le nanocorps tel que défini dans l'une quelconque des revendications 1 à 6.

15. Vecteur comprenant un acide nucléique tel que défini dans la revendication 14. 16. Cellule transfectée, transduite ou transformée avec un acide nucléique selon la revendication 14 ou un vecteur selon la revendication 15.

17. Méthode de production d'une cellule hôte recombinante exprimant un nanocorps tel que défini selon l'une quelconque des revendications 1 à 6, ladite méthode comprenant les étapes consistant à :

(i) introduire in vitro ou ex vivo un acide nucléique selon la revendication 14 ou un vecteur selon la revendication 15 dans une cellule hôte compétente,

(ii) cultiver in vitro ou ex vivo la cellule hôte recombinante obtenue et

(iii) éventuellement sélectionner les cellules qui expriment et/ou sécrètent ledit nanocorps.

18. Méthode de production d'un nanocorps tel que défini selon l'une quelconque des revendications 1 à 6, ladite méthode comprenant les étapes consistant à :

(i) cultiver une cellule transduite ou transfectée ou transformée selon la revendication 16, dans des conditions appropriées pour permettre l'expression dudit nanocorps, et

(ii) récupérer le nanocorps exprimé.

Download Citation


Sign in to the Lens

Feedback