{"search_session":{},"preferences":{"l":"en","queryLanguage":"en"},"patentId":"194-648-341-372-564","frontPageModel":{"patentViewModel":{"ref":{"entityRefType":"PATENT","entityRefId":"194-648-341-372-564"},"entityMetadata":{"linkedIds":{"empty":true},"tags":[],"collections":[{"id":8904,"type":"PATENT","title":"Univ Washington Patent Portfolio","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":15386,"tags":[],"user":{"id":91044780,"username":"Cambialens","firstName":"","lastName":"","created":"2015-05-04T00:55:26.000Z","displayName":"Cambialens","preferences":"{\"usage\":\"public\",\"beta\":false}","accountType":"PERSONAL","isOauthOnly":false},"notes":[{"id":8219,"type":"COLLECTION","user":{"id":91044780,"username":"Cambialens","firstName":"","lastName":"","created":"2015-05-04T00:55:26.000Z","displayName":"Cambialens","preferences":"{\"usage\":\"public\",\"beta\":false}","accountType":"PERSONAL","isOauthOnly":false},"text":"
Search applicants and owners= \"Univ Washington', \"Washington Univ\", \"University of Washington\", \" Washington University\", \"Univ Washington NOT state\", \" Univ Washington NOT state NOT George\".
Select more for logical variants
Add to collection
Total patent: 10892
Search applicants and owners= \"Univ Washington', \"Washington Univ\", \"University of Washington\", \" Washington University\", \"Univ Washington NOT state\", \" Univ Washington NOT state NOT George\".
Select more for logical variants
Add to collection
Total patent: 10892
R1-R2-Phe-R3-R4-R5-R6-R7-R8-R9-R10-R11-R12-R13-R14-R15-R16-X1-R17 (SEQ ID NO: 2), wherein\n
R1 is selected from the group consisting of Ser, Ala, Phe, His, Lys, Met, Asn, Gln, Thr, Val, Tyr, and Asp;\n
R2 can be any amino acid;\n
R3 is selected from the group consisting of Asp, Ala, Glu, Gly, Asn, Pro, Ser, and Tyr;\n
R4 is selected from the group consisting of Leu and Phe;\n
R5 can be any amino acid;\n
R6 is selected from the group consisting of Met, Phe, His, Ile, Leu, Gln, and Thr;\n
R7 is selected from the group consisting of Arg, Gly, Lys, Gln, and Thr;\n
R8 is selected from the group consisting of Ile, Asn, Gln, Val, and Trp;\n
R9 is selected from the group consisting of Met, Gly, Ile, Lys, Leu, Asn, Arg, Ser, Thr, Val, His, and Tyr;\n
R10 is selected from the group consisting of Trp and Phe;\n
R11 is selected from the group consisting of Ile, Phe, Ser, Thr, and Val;\n
R12 is selected from the group consisting of Tyr, Cys, Asp, Phe, His, Asn, and Ser;\n
R13 is selected from the group consisting of Val, Ala, Phe, Ile, Leu, Asn, Gln, Thr, and Tyr;\n
R14 is selected from the group consisting of Phe, Glu, and Leu;\n
R15 is selected from the group consisting of Ala, Gly, Lys, Arg, and Ser;\n
R16 is selected from the group consisting of Phe, Cys, His, Lys, Leu, Met, Asn, Gln, Arg, Thr, Val, Trp, and Tyr;\n
X1 is the amino acid sequence Z1-Arg-Z2-Ile-Pro (SEQ ID NO: 3), wherein Z1 is Lys or Asn, and Z2 is selected from the group consisting of Lys, Pro, Gln, and Thr; and\n
R17 is Phe or Tyr."],"number":1,"annotation":false,"title":false,"claim":true},{"lines":["The polypeptide of claim 1, wherein Z2 is Gln."],"number":2,"annotation":false,"title":false,"claim":true},{"lines":["The polypeptide of claim 1, wherein general formula I is A1-R1-R2-Phe-R3-R4-R5-R6-R7-R8-R9-R10-R11-R12-R13-R14-R15-R16-X1-R17-B1 (SEQ ID NO: 4), wherein one or both of A1 and B1 are present, and wherein A1 comprises the amino acid sequence:\n
MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(D/V/Y/F)EA(A/D)(A/K/R/E)VL(Q/K)A VY(E/A)T(N/D/E) (SEQ ID NO: 5); and\n
B1 comprises the amino acid sequence (L/A/V/D/I/P)HA(Q/P)KLARRLLELK(Q/L)AASSPLP (SEQ ID NO: 6)."],"number":3,"annotation":false,"title":false,"claim":true},{"lines":["The polypeptide of claim 3, wherein A1 is present and comprises the amino acid sequence MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(F)EA(A/D)(E)VL(Q/K)AVY(E/A)T(E) (SEQ ID NO: 279)."],"number":4,"annotation":false,"title":false,"claim":true},{"lines":["The polypeptide of claim 3, wherein B1 is present and comprises the amino acid sequence (D/I/P)HA(Q/P)KLARRLLELK(Q/L)AASSPLP (SEQ ID NO: 278)."],"number":5,"annotation":false,"title":false,"claim":true},{"lines":["The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence selected from the group consisting of\n(SEQ ID NO: 33)SAFDLAMRIHWIYNFAF; (SEQ ID NO: 281)HAFDLAMRIHWIYNFAF; (SEQ ID NO: 33)SAFDLAMRIHWIYNFAF; (SEQ ID NO. 282)SAFDLAMRIMWIYVFAY (SEQ ID NO. 283)HAFDLAMRIMWIYVFAY (SEQ ID NO: 30)SAFDLAMRIHWIYNFAFKRKIPF; (SEQ ID NO: 284)HAFDLAMRIHWIYNFAFKRKIPF; (SEQ ID NO: 30)SAFDLAMRIHWIYNFAFKRKIPF; (SEQ ID NO: 285)(33Y)EA(36A)(37E)VL(40K)AVY(44E)T(46E)SAFDLAMRIHWI YNFAFKRPIPFP; (SEQ ID NO: 286)(33D)EA(36A)(37R)VL(40K)AVY(44E)T(46D)SAFDLAMRIHWI YNFAFKRPIPFP; (SEQ ID NO: 287)(33Y)EA(36D)(37E)VL(40K)AVY(44E)T(46N)SAFDLAMRIHWI YNFAFKRPIPFP; (SEQ ID NO: 288)(33V)EA(36A)(37R)VL(40Q)AVY(44E)T(46N)SAFDLAMRI- WIYNFAFKRPIPFP; (SEQ ID NO: 289)(33V)EA(36D)(37K)VL(40Q)AVY(44E)T(46N)SAFDLAMRIHWI YNFAFKRPIPFP; (SEQ ID NO: 290)(33V)EA(36D)(37A)VL(40K)AVY(44A)T(46N)SAFDLAMRIHWI YNFAFKRPIPFP; (SEQ ID NO: 291)(33Y)EA(36A)(37E)VL(40K)AVY(44E)T(46E)HAFDLAMRIHWI YNFAFKRPIPFP; (SEQ ID NO: 292)(33Y)EA(36A)(37E)VL(40E)AVY(44E)T(46E)SAFDLAMRIHWI YNFAFKRPIPFP; (SEQ ID NO: 293)(33Y)EA(36A)(37E)VL(40K)AVY(44E)T(46E)SAFDLAMRIHWI YNFAFKRPIPFP; (SEQ ID NO: 351)SAFDLAMRIMWIYVFAYNRPIPF(HB36.3); (SEQ ID NO: 282)SAFDLAMRIMWIYVFAY(HB36.3 and HB36.4); (SEQ ID NO: 352)SAFDLAMRIMWIYVFAYKRPIPF(HB36.4); (SEQ ID NO: 352)SAFDLAMRIMWIYVFAYKRPIPF; (SEQ ID NO: 353)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEAEAVLQAVYETESAFD LAMRIMWIYVFAYKRPIPFPHAQKLARRLLELKQAASSPLPLE; (SEQ ID NO: 354)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEAEAVLQAVYETESAFD LAMRIMWIYVFAYNRPIPFSHAQKLARRLLELKQAASSPLPLE; (SEQ ID NO: 294)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(33Y)EA(36A)(37E) VL(40K)AVY(44E)T(46E)SAFDLAMRIHWIYNFAFKRPIPFPPHAQ KLARRLLELKQAASSPLPLE; (SEQ ID NO: 295)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(33D)EA(36A)(37R) VL(40K)AVY(44E)T(46D)SAFDLAMRIHWIYNFAFKRPIPFPPHAQ KLARRLLELKQAASSPLPLE; (SEQ ID NO: 296)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(33Y)EA(36D)(37E) VL(40K)AVY(44E)T(46N)SAFDLAMRIHWIYNFAFKRPIPFPPHAQ KLARRLLELKQAASSPLPLE; (SEQ ID NO: 297)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(33V)EA(36A)(37R) VL(40Q)AVY(44E)T(46N)SAFDLAMRI- WIYNFAFKRPIPFPPHAQKLARRLLELKQAASSPLPLE; (SEQ ID NO: 298)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(33V)EA(36D)(37K) VL(40Q)AVY(44E)T(46N)SAFDLAMRIHWIYNFAFKRPIPFPPHAQ KLARRLLELKQAASSPLPLE; (SEQ ID NO: 299)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(33V)EA(36D)(37A) VL(40K)AVY(44A)T(46N)SAFDLAMRIHWIYNFAFKRPIPFPPHAQ KLARRLLELKQAASSPLPLE; (SEQ ID NO: 300)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(33Y)EA(36A)(37E) VL(40K)AVY(44E)T(46E)HAFDLAMRIHWIYNFAFKRPIPFPPHAQ KLARRLLELKQAASSPLPLE; (SEQ ID NO: 301)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(33Y)EA(36A)(37E) VL(40E)AVY(44E)T(46E)SAFDLAMRIHWIYNFAFKRPIPFPPHAQ KLARRLLELKQAASSPLPLE; and (SEQ ID NO: 302)MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(33Y)EA(36A)(37E) VL(40K)AVY(44E)T(46E)SAFDLAMRIHWIYNFAFKRPIPFPPHAQ KLARRLLELKQAASSPLPLE."],"number":6,"annotation":false,"title":false,"claim":true},{"lines":["The polypeptide according to claim 1, wherein the polypeptide comprises a detectable tag."],"number":7,"annotation":false,"title":false,"claim":true},{"lines":["A pharmaceutical composition, comprising one or more polypeptides according to claim 1 and a pharmaceutically acceptable carrier."],"number":8,"annotation":false,"title":false,"claim":true},{"lines":["The polypeptide of claim 4, wherein B1 is present and comprises the amino acid sequence (D/I/P)HA(Q/P)KLARRLLELK(Q/L)AASSPLP (SEQ ID NO: 278)."],"number":9,"annotation":false,"title":false,"claim":true},{"lines":["The polypeptide of claim 1, wherein the polypeptide comprises the amino acid sequence SAFDLAMRIMWIYVFAFKRPIPF (SEQ ID NO:8)."],"number":10,"annotation":false,"title":false,"claim":true},{"lines":["The polypeptide of claim 1, wherein the polypeptide comprises the amino acid sequence of SEQ ID NO:65."],"number":11,"annotation":false,"title":false,"claim":true},{"lines":["The polypeptide of claim 1, wherein the polypeptide consists of the amino acid sequence of SEQ ID NO:65."],"number":12,"annotation":false,"title":false,"claim":true},{"lines":["A method for treating and/or limiting an influenza infection, comprising administering to a subject in need thereof a therapeutically effective amount of one or more polypeptides according to claim 1, conjugates thereof, or pharmaceutical compositions thereof, to treat and/or limit the influenza infection."],"number":13,"annotation":false,"title":false,"claim":true},{"lines":["A method for diagnosing an influenza infection, or monitoring progression of an influenza infection, comprising\n
(a) contacting a biological sample from a subject suspected of having an influenza infection with a diagnostically effective amount of one or more polypeptides according to claim 1 under conditions suitable for binding of the polypeptide to a viral HA protein present in the sample; and\n
(b) detecting polypeptide-viral HA binding complexes,\n
where the presence of such binding complexes indicates that the subject has an influenza infection, or provides a measure progression of an influenza infection."],"number":14,"annotation":false,"title":false,"claim":true},{"lines":["The method of claim 13, wherein the one or more polypeptides are of general formula I wherein is A1-R1-R2-Phe-R3-R4-R5-R6-R7-R8-R9-R10-R11-R12-R13-R14-R15-R16-X1-R17-B1 (SEQ ID NO: 4), wherein one or both of A1 and B1 are present, and wherein A1 comprises the amino acid sequence:\n
MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(D/V/Y/F)EA(A/D)(A/K/R/E)VL (Q/K)AVY(E/A)T(N/D/E) (SEQ ID NO: 5); and\n
B1 comprises the amino acid sequence (L/A/V/D/I/P)HA(Q/P)KLARRLLELK(Q/L)AASSPLP (SEQ ID NO: 6)."],"number":15,"annotation":false,"title":false,"claim":true},{"lines":["The method of claim 15, wherein A1 and B1 are both present, and wherein A1 comprises the amino acid sequence\n
MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(F)EA(A/D)(E)VL(Q/K)AVY(E/A)T(E) (SEQ ID NO: 279), and B1 comprises the amino acid sequence (D/I/P)HA(Q/P)KLARRLLELK(Q/L)AASSPLP (SEQ ID NO: 278)."],"number":16,"annotation":false,"title":false,"claim":true},{"lines":["The method of claim 15, wherein the polypeptide comprises the amino acid sequence of a peptide selected from the group consisting of SEQ ID NOS: 30, 33, 65, 281-302, and 351-354."],"number":17,"annotation":false,"title":false,"claim":true},{"lines":["The method of claim 16, wherein the one or more polypeptides are of general formula I wherein is A1-R1-R2-Phe-R3-R4-R5-R6-R7-R8-R9-R10-R11-R12-R13-R14-R15-R16-X1-R17-B1 (SEQ ID NO: 4), wherein one or both of A1 and B1 are present, and wherein A1 comprises the amino acid sequence:\n
MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(D/V/Y/F)EA(A/D)(A/K/R/E)VL (Q/K)AVY(E/A)T(N/D/E) (SEQ ID NO: 5); and\n
B1 comprises the amino acid sequence (L/A/V/D/I/P)HA(Q/P)KLARRLLELK(Q/L)AASSPLP (SEQ ID NO: 6)."],"number":18,"annotation":false,"title":false,"claim":true},{"lines":["The method of claim 18, wherein A1 and B1 are both present, and wherein A1 comprises the amino acid sequence\n
MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYD(F)EA(A/D)(E)VL(Q/K)AVY(E/A)T(E) (SEQ ID NO: 279), and B1 comprises the amino acid sequence (D/I/P)HA(Q/P)KLARRLLELK(Q/L)AASSPLP (SEQ ID NO: 278)."],"number":19,"annotation":false,"title":false,"claim":true},{"lines":["The method of claim 14, wherein the polypeptide comprises the amino acid sequence of a peptide selected from the group consisting of SEQ ID NOS: 30, 33, 65, 28 1-302, and 351-354."],"number":20,"annotation":false,"title":false,"claim":true}]}},"filters":{"npl":[],"notNpl":[],"applicant":[],"notApplicant":[],"inventor":[],"notInventor":[],"owner":[],"notOwner":[],"tags":[],"dates":[],"types":[],"notTypes":[],"j":[],"notJ":[],"fj":[],"notFj":[],"classIpcr":[],"notClassIpcr":[],"classNat":[],"notClassNat":[],"classCpc":[],"notClassCpc":[],"so":[],"notSo":[],"sat":[]},"sequenceFilters":{"s":"SEQIDNO","d":"ASCENDING","p":0,"n":10,"sp":[],"si":[],"len":[],"t":[],"loc":[]}}