{"search_session":{},"preferences":{"l":"en","queryLanguage":"en"},"patentId":"040-676-874-921-89X","frontPageModel":{"patentViewModel":{"ref":{"entityRefId":"040-676-874-921-89X","entityRefType":"PATENT"},"entityMetadata":{"linkedIds":{"empty":true},"tags":[],"collections":[{"id":22724,"type":"PATENT","title":"Citing Univ Wurzburg publications","description":"Patent documents citing scholarly work of Univ Wurzburg","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":15059,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:41:01Z","updated":"2017-08-07T04:41:01Z","lastEventDate":"2017-08-07T04:41:01Z"},{"id":22727,"type":"PATENT","title":"Citing Keio Univ publications","description":"Patent documents citing scholarly work of Keio Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":11711,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:41:37Z","updated":"2017-08-07T04:41:37Z","lastEventDate":"2017-08-07T04:41:37Z"},{"id":22739,"type":"PATENT","title":"Citing KU Leuven publications","description":"Patent documents citing scholarly work of KU Leuven","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":30113,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:46:44Z","updated":"2017-08-07T04:46:44Z","lastEventDate":"2017-08-07T04:46:44Z"},{"id":22757,"type":"PATENT","title":"Citing Cornell Univ publications","description":"Patent documents citing scholarly work of Cornell Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":60392,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:53:01Z","updated":"2017-08-07T04:53:01Z","lastEventDate":"2017-08-07T04:53:01Z"},{"id":22773,"type":"PATENT","title":"Citing Univ Washington publications","description":"Patent documents citing scholarly work of Univ Washington","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":75126,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:58:47Z","updated":"2017-08-07T04:58:47Z","lastEventDate":"2017-08-07T04:58:47Z"},{"id":22777,"type":"PATENT","title":"Citing Univ Zurich publications","description":"Patent documents citing scholarly work of Univ Zurich","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":26786,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:00:56Z","updated":"2017-08-07T05:00:56Z","lastEventDate":"2017-08-07T05:00:56Z"},{"id":22789,"type":"PATENT","title":"Citing NUS publications","description":"Patent documents citing scholarly work of NUS","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":19273,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:05:12Z","updated":"2017-08-07T05:05:12Z","lastEventDate":"2017-08-07T05:05:12Z"},{"id":22795,"type":"PATENT","title":"Citing Wageningen Univ publications","description":"Patent documents citing scholarly work of Wageningen Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":8920,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:08:48Z","updated":"2017-08-07T05:08:48Z","lastEventDate":"2017-08-07T05:08:48Z"},{"id":22798,"type":"PATENT","title":"Citing Univ Edinburgh publications","description":"Patent documents citing scholarly work of Univ Edinburgh","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":21541,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:09:07Z","updated":"2017-08-07T05:09:07Z","lastEventDate":"2017-08-07T05:09:07Z"},{"id":22800,"type":"PATENT","title":"Citing Baylor College Med publications","description":"Patent documents citing scholarly work of Baylor College Med","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":37085,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:09:55Z","updated":"2017-08-07T05:09:55Z","lastEventDate":"2017-08-07T05:09:55Z"},{"id":22812,"type":"PATENT","title":"Citing Univ Erlangen Nuremberg publications","description":"Patent documents citing scholarly work of Univ Erlangen Nuremberg","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":18431,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:18:36Z","updated":"2017-08-07T05:18:36Z","lastEventDate":"2017-08-07T05:18:36Z"},{"id":22816,"type":"PATENT","title":"Citing Heidelberg Univ publications","description":"Patent documents citing scholarly work of Heidelberg Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":26439,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:19:30Z","updated":"2017-08-07T05:19:30Z","lastEventDate":"2017-08-07T05:19:30Z"},{"id":22818,"type":"PATENT","title":"Citing Univ Melbourne publications","description":"Patent documents citing scholarly work of Univ Melbourne","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":19461,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:22:25Z","updated":"2017-08-15T06:22:25Z","lastEventDate":"2017-08-15T06:22:25Z"},{"id":22824,"type":"PATENT","title":"Citing Rockefeller Univ publications","description":"Patent documents citing scholarly work of Rockefeller Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":32455,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:22:00Z","updated":"2017-08-07T05:22:00Z","lastEventDate":"2017-08-07T05:22:00Z"},{"id":22831,"type":"PATENT","title":"Citing Univ Minnesota Twin Cities publications","description":"Patent documents citing scholarly work of Univ Minnesota Twin Cities","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":52155,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:24:37Z","updated":"2017-08-07T05:24:37Z","lastEventDate":"2017-08-07T05:24:37Z"},{"id":22845,"type":"PATENT","title":"Citing Uppsala Univ publications","description":"Patent documents citing scholarly work of Uppsala Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":24847,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:29:57Z","updated":"2017-08-07T05:29:57Z","lastEventDate":"2017-08-07T05:29:57Z"},{"id":22850,"type":"PATENT","title":"Citing Oregon Health Science Univ publications","description":"Patent documents citing scholarly work of Oregon Health Science Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":16957,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:32:56Z","updated":"2017-08-07T05:32:56Z","lastEventDate":"2017-08-07T05:32:56Z"},{"id":22856,"type":"PATENT","title":"Citing NIH publications","description":"Patent documents citing scholarly work of NIH","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":151649,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:35:15Z","updated":"2017-08-07T05:35:15Z","lastEventDate":"2017-08-07T05:35:15Z"},{"id":22859,"type":"PATENT","title":"Citing Harvard Univ publications","description":"Patent documents citing scholarly work of Harvard Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":175224,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:37:44Z","updated":"2017-08-07T05:37:44Z","lastEventDate":"2017-08-07T05:37:44Z"},{"id":22864,"type":"PATENT","title":"Citing Ohio State Univ publications","description":"Patent documents citing scholarly work of Ohio State Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":31507,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:42:04Z","updated":"2017-08-07T05:42:04Z","lastEventDate":"2017-08-07T05:42:04Z"},{"id":22872,"type":"PATENT","title":"Citing Free Univ Berlin publications","description":"Patent documents citing scholarly work of Free Univ Berlin","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":28928,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:44:55Z","updated":"2017-08-07T05:44:55Z","lastEventDate":"2017-08-07T05:44:55Z"},{"id":22873,"type":"PATENT","title":"Citing Columbia Univ publications","description":"Patent documents citing scholarly work of Columbia Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":56716,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:45:21Z","updated":"2017-08-07T05:45:21Z","lastEventDate":"2017-08-07T05:45:21Z"},{"id":22876,"type":"PATENT","title":"Citing Univ Virginia publications","description":"Patent documents citing scholarly work of Univ Virginia","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":27785,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:46:41Z","updated":"2017-08-07T05:46:41Z","lastEventDate":"2017-08-07T05:46:41Z"},{"id":22882,"type":"PATENT","title":"Citing NTU publications","description":"Patent documents citing scholarly work of NTU","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":8075,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:49:58Z","updated":"2017-08-07T05:49:58Z","lastEventDate":"2017-08-07T05:49:58Z"},{"id":22886,"type":"PATENT","title":"Citing Univ Texas System publications","description":"Patent documents citing scholarly work of Univ Texas System","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":110344,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:51:34Z","updated":"2017-08-07T05:51:34Z","lastEventDate":"2017-08-07T05:51:34Z"},{"id":22912,"type":"PATENT","title":"Citing Univ Basel publications","description":"Patent documents citing scholarly work of Univ Basel","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":16553,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T06:01:42Z","updated":"2017-08-07T06:01:42Z","lastEventDate":"2017-08-07T06:01:42Z"},{"id":22914,"type":"PATENT","title":"Citing Yale Univ publications","description":"Patent documents citing scholarly work of Yale Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":53591,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T06:01:58Z","updated":"2017-08-07T06:01:58Z","lastEventDate":"2017-08-07T06:01:58Z"},{"id":23024,"type":"PATENT","title":"Citing The University of New South Wales publications","description":"Patent documents citing scholarly work of The University of New South Wales","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":11568,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:21:04Z","updated":"2017-08-15T06:21:04Z","lastEventDate":"2017-08-15T06:21:04Z"},{"id":23039,"type":"PATENT","title":"Citing St Vincents Institute of Medical Research publications","description":"Patent documents citing scholarly work of St Vincents Institute of Medical Research","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":2999,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:22:50Z","updated":"2017-08-15T06:22:50Z","lastEventDate":"2017-08-15T06:22:50Z"},{"id":23051,"type":"PATENT","title":"Citing The University of Sydney publications","description":"Patent documents citing scholarly work of The University of Sydney","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":18635,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:23:49Z","updated":"2017-08-15T06:23:49Z","lastEventDate":"2017-08-15T06:23:49Z"},{"id":23053,"type":"PATENT","title":"Citing Monash University publications","description":"Patent documents citing scholarly work of Monash University","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":15586,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:24:16Z","updated":"2017-08-15T06:24:16Z","lastEventDate":"2017-08-15T06:24:16Z"},{"id":23056,"type":"PATENT","title":"Citing Garvan Institute of Medical Research publications","description":"Patent documents citing scholarly work of Garvan Institute of Medical Research","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":2662,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:24:46Z","updated":"2017-08-15T06:24:46Z","lastEventDate":"2017-08-15T06:24:46Z"},{"id":182292,"type":"PATENT","title":"BIOFARMA_CIP","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":46579,"tags":[],"user":{"id":354789823,"username":"neburevilo","firstName":"","lastName":"","created":"2020-05-27T12:14:20.000Z","displayName":"neburevilo","preferences":"{\"usage\":\"public\"}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2020-06-29T14:05:03Z","updated":"2020-06-29T14:07:29Z","lastEventDate":"2020-06-29T14:07:29Z"},{"id":182990,"type":"PATENT","title":"2","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":49434,"tags":[],"user":{"id":320339875,"username":"tadro.abbott@csiro.au","firstName":"Tadro","lastName":"Abbott","created":"2019-06-27T07:11:33.000Z","displayName":"Tadro Abbott","preferences":"{\"usage\":\"public\"}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2020-08-10T01:50:08Z","updated":"2020-08-10T01:54:38Z","lastEventDate":"2020-08-10T01:54:38Z"},{"id":183532,"type":"PATENT","title":"Electricity - Ultra-Low-Cost Electricity Storage (Citing Patents)","description":"Patents citing scholarly works in Ultra-Low-Cost Electricity Storage","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":13809,"tags":[],"user":{"id":369423973,"username":"Lens Reports","firstName":"Lens","lastName":"Reports","created":"2020-09-16T23:25:18.000Z","displayName":"Lens Reports","profilePictureKey":"lens/avatar/00bf8c3d-2675-48ad-9d6e-5cf58c675620","avatar":{"id":1069,"key":"lens/avatar/00bf8c3d-2675-48ad-9d6e-5cf58c675620"},"preferences":"{\"beta\":true,\"usage\":\"public\"}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":true,"savedQueries":[{"id":50012,"title":"Ultra-Low-Cost Electricity Storage (Citing Patents)","queryId":"a2812ba4-c922-4815-87ed-8e1487fc0cc2"}],"created":"2020-09-21T01:12:10Z","updated":"2023-11-16T00:11:27Z","lastEventDate":"2023-11-16T00:11:27Z"},{"id":185688,"type":"PATENT","title":"Food Safety","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":50000,"tags":[],"user":{"id":379426745,"username":"guzmanbarcenas","firstName":"","lastName":"","created":"2020-11-27T23:02:26.000Z","displayName":"guzmanbarcenas","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2020-11-27T23:38:28Z","updated":"2020-11-27T23:40:39Z","lastEventDate":"2020-11-27T23:40:39Z"},{"id":185689,"type":"PATENT","title":"Food Safety and Management Systems","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":50000,"tags":[],"user":{"id":379426745,"username":"guzmanbarcenas","firstName":"","lastName":"","created":"2020-11-27T23:02:26.000Z","displayName":"guzmanbarcenas","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":true,"savedQueries":[],"created":"2020-11-27T23:43:53Z","updated":"2020-11-27T23:45:31Z","lastEventDate":"2020-11-27T23:45:31Z"},{"id":195131,"type":"PATENT","title":"Electrochemical Biosensors OR Biosensors AND Leukemia Diagnostics OR Leukemia","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":28822,"tags":[],"user":{"id":390700588,"username":"diegot","firstName":"Diego","lastName":"Triviño Bolaños","created":"2021-02-12T02:57:12.000Z","displayName":"Diego Triviño Bolaños","profilePictureKey":"lens/avatar/92b0de89-d77f-4973-b88a-4a0e06ac93e4","avatar":{"id":977,"key":"lens/avatar/92b0de89-d77f-4973-b88a-4a0e06ac93e4"},"preferences":"{}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":true,"savedQueries":[],"created":"2021-09-23T03:43:35Z","updated":"2024-03-28T02:26:34Z","lastEventDate":"2024-03-28T02:26:34Z"},{"id":208861,"type":"PATENT","title":"sarcopenia y nutricion","description":"tema relacionado con sarcopenia y uso de nutraceuticos","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":9715,"tags":[],"user":{"id":502976179,"username":"luisagil","firstName":"","lastName":"","created":"2023-04-14T21:38:42.000Z","displayName":"luisagil","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2023-04-14T21:51:45Z","updated":"2023-04-14T21:51:46Z","lastEventDate":"2023-04-14T21:51:46Z"},{"id":215576,"type":"PATENT","title":"US_Granted_Active_A61P","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":50000,"tags":[],"user":{"id":416214387,"username":"pi3kakt","firstName":"Yu Ren","lastName":"Wang","created":"2021-08-15T09:18:15.000Z","displayName":"Yu Ren Wang","preferences":"{\"usage\":\"public\"}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2023-12-12T09:26:41Z","updated":"2023-12-12T09:26:44Z","lastEventDate":"2023-12-12T09:26:44Z"}],"notes":[],"inventorships":[],"privateCollections":[],"publicCollections":[{"id":22724,"type":"PATENT","title":"Citing Univ Wurzburg publications","description":"Patent documents citing scholarly work of Univ Wurzburg","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":15059,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:41:01Z","updated":"2017-08-07T04:41:01Z","lastEventDate":"2017-08-07T04:41:01Z"},{"id":22727,"type":"PATENT","title":"Citing Keio Univ publications","description":"Patent documents citing scholarly work of Keio Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":11711,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:41:37Z","updated":"2017-08-07T04:41:37Z","lastEventDate":"2017-08-07T04:41:37Z"},{"id":22739,"type":"PATENT","title":"Citing KU Leuven publications","description":"Patent documents citing scholarly work of KU Leuven","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":30113,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:46:44Z","updated":"2017-08-07T04:46:44Z","lastEventDate":"2017-08-07T04:46:44Z"},{"id":22757,"type":"PATENT","title":"Citing Cornell Univ publications","description":"Patent documents citing scholarly work of Cornell Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":60392,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:53:01Z","updated":"2017-08-07T04:53:01Z","lastEventDate":"2017-08-07T04:53:01Z"},{"id":22773,"type":"PATENT","title":"Citing Univ Washington publications","description":"Patent documents citing scholarly work of Univ Washington","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":75126,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T04:58:47Z","updated":"2017-08-07T04:58:47Z","lastEventDate":"2017-08-07T04:58:47Z"},{"id":22777,"type":"PATENT","title":"Citing Univ Zurich publications","description":"Patent documents citing scholarly work of Univ Zurich","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":26786,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:00:56Z","updated":"2017-08-07T05:00:56Z","lastEventDate":"2017-08-07T05:00:56Z"},{"id":22789,"type":"PATENT","title":"Citing NUS publications","description":"Patent documents citing scholarly work of NUS","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":19273,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:05:12Z","updated":"2017-08-07T05:05:12Z","lastEventDate":"2017-08-07T05:05:12Z"},{"id":22795,"type":"PATENT","title":"Citing Wageningen Univ publications","description":"Patent documents citing scholarly work of Wageningen Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":8920,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:08:48Z","updated":"2017-08-07T05:08:48Z","lastEventDate":"2017-08-07T05:08:48Z"},{"id":22798,"type":"PATENT","title":"Citing Univ Edinburgh publications","description":"Patent documents citing scholarly work of Univ Edinburgh","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":21541,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:09:07Z","updated":"2017-08-07T05:09:07Z","lastEventDate":"2017-08-07T05:09:07Z"},{"id":22800,"type":"PATENT","title":"Citing Baylor College Med publications","description":"Patent documents citing scholarly work of Baylor College Med","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":37085,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:09:55Z","updated":"2017-08-07T05:09:55Z","lastEventDate":"2017-08-07T05:09:55Z"},{"id":22812,"type":"PATENT","title":"Citing Univ Erlangen Nuremberg publications","description":"Patent documents citing scholarly work of Univ Erlangen Nuremberg","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":18431,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:18:36Z","updated":"2017-08-07T05:18:36Z","lastEventDate":"2017-08-07T05:18:36Z"},{"id":22816,"type":"PATENT","title":"Citing Heidelberg Univ publications","description":"Patent documents citing scholarly work of Heidelberg Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":26439,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:19:30Z","updated":"2017-08-07T05:19:30Z","lastEventDate":"2017-08-07T05:19:30Z"},{"id":22818,"type":"PATENT","title":"Citing Univ Melbourne publications","description":"Patent documents citing scholarly work of Univ Melbourne","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":19461,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:22:25Z","updated":"2017-08-15T06:22:25Z","lastEventDate":"2017-08-15T06:22:25Z"},{"id":22824,"type":"PATENT","title":"Citing Rockefeller Univ publications","description":"Patent documents citing scholarly work of Rockefeller Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":32455,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:22:00Z","updated":"2017-08-07T05:22:00Z","lastEventDate":"2017-08-07T05:22:00Z"},{"id":22831,"type":"PATENT","title":"Citing Univ Minnesota Twin Cities publications","description":"Patent documents citing scholarly work of Univ Minnesota Twin Cities","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":52155,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:24:37Z","updated":"2017-08-07T05:24:37Z","lastEventDate":"2017-08-07T05:24:37Z"},{"id":22845,"type":"PATENT","title":"Citing Uppsala Univ publications","description":"Patent documents citing scholarly work of Uppsala Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":24847,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:29:57Z","updated":"2017-08-07T05:29:57Z","lastEventDate":"2017-08-07T05:29:57Z"},{"id":22850,"type":"PATENT","title":"Citing Oregon Health Science Univ publications","description":"Patent documents citing scholarly work of Oregon Health Science Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":16957,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:32:56Z","updated":"2017-08-07T05:32:56Z","lastEventDate":"2017-08-07T05:32:56Z"},{"id":22856,"type":"PATENT","title":"Citing NIH publications","description":"Patent documents citing scholarly work of NIH","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":151649,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:35:15Z","updated":"2017-08-07T05:35:15Z","lastEventDate":"2017-08-07T05:35:15Z"},{"id":22859,"type":"PATENT","title":"Citing Harvard Univ publications","description":"Patent documents citing scholarly work of Harvard Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":175224,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:37:44Z","updated":"2017-08-07T05:37:44Z","lastEventDate":"2017-08-07T05:37:44Z"},{"id":22864,"type":"PATENT","title":"Citing Ohio State Univ publications","description":"Patent documents citing scholarly work of Ohio State Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":31507,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:42:04Z","updated":"2017-08-07T05:42:04Z","lastEventDate":"2017-08-07T05:42:04Z"},{"id":22872,"type":"PATENT","title":"Citing Free Univ Berlin publications","description":"Patent documents citing scholarly work of Free Univ Berlin","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":28928,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:44:55Z","updated":"2017-08-07T05:44:55Z","lastEventDate":"2017-08-07T05:44:55Z"},{"id":22873,"type":"PATENT","title":"Citing Columbia Univ publications","description":"Patent documents citing scholarly work of Columbia Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":56716,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:45:21Z","updated":"2017-08-07T05:45:21Z","lastEventDate":"2017-08-07T05:45:21Z"},{"id":22876,"type":"PATENT","title":"Citing Univ Virginia publications","description":"Patent documents citing scholarly work of Univ Virginia","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":27785,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:46:41Z","updated":"2017-08-07T05:46:41Z","lastEventDate":"2017-08-07T05:46:41Z"},{"id":22882,"type":"PATENT","title":"Citing NTU publications","description":"Patent documents citing scholarly work of NTU","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":8075,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:49:58Z","updated":"2017-08-07T05:49:58Z","lastEventDate":"2017-08-07T05:49:58Z"},{"id":22886,"type":"PATENT","title":"Citing Univ Texas System publications","description":"Patent documents citing scholarly work of Univ Texas System","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":110344,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T05:51:34Z","updated":"2017-08-07T05:51:34Z","lastEventDate":"2017-08-07T05:51:34Z"},{"id":22912,"type":"PATENT","title":"Citing Univ Basel publications","description":"Patent documents citing scholarly work of Univ Basel","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":16553,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T06:01:42Z","updated":"2017-08-07T06:01:42Z","lastEventDate":"2017-08-07T06:01:42Z"},{"id":22914,"type":"PATENT","title":"Citing Yale Univ publications","description":"Patent documents citing scholarly work of Yale Univ","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":53591,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-07T06:01:58Z","updated":"2017-08-07T06:01:58Z","lastEventDate":"2017-08-07T06:01:58Z"},{"id":23024,"type":"PATENT","title":"Citing The University of New South Wales publications","description":"Patent documents citing scholarly work of The University of New South Wales","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":11568,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:21:04Z","updated":"2017-08-15T06:21:04Z","lastEventDate":"2017-08-15T06:21:04Z"},{"id":23039,"type":"PATENT","title":"Citing St Vincents Institute of Medical Research publications","description":"Patent documents citing scholarly work of St Vincents Institute of Medical Research","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":2999,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:22:50Z","updated":"2017-08-15T06:22:50Z","lastEventDate":"2017-08-15T06:22:50Z"},{"id":23051,"type":"PATENT","title":"Citing The University of Sydney publications","description":"Patent documents citing scholarly work of The University of Sydney","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":18635,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:23:49Z","updated":"2017-08-15T06:23:49Z","lastEventDate":"2017-08-15T06:23:49Z"},{"id":23053,"type":"PATENT","title":"Citing Monash University publications","description":"Patent documents citing scholarly work of Monash University","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":15586,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:24:16Z","updated":"2017-08-15T06:24:16Z","lastEventDate":"2017-08-15T06:24:16Z"},{"id":23056,"type":"PATENT","title":"Citing Garvan Institute of Medical Research publications","description":"Patent documents citing scholarly work of Garvan Institute of Medical Research","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":2662,"tags":[],"user":{"id":233682368,"username":"tech","firstName":"The Lens","lastName":"Team","created":"2017-08-06T20:11:49.000Z","displayName":"The Lens Team","profilePictureKey":"lens/users/15eac2a0-031d-4923-92cb-a162e1cb2bbb/profile-picture","preferences":"{\"beta\":true}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2017-08-15T06:24:46Z","updated":"2017-08-15T06:24:46Z","lastEventDate":"2017-08-15T06:24:46Z"},{"id":182292,"type":"PATENT","title":"BIOFARMA_CIP","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":46579,"tags":[],"user":{"id":354789823,"username":"neburevilo","firstName":"","lastName":"","created":"2020-05-27T12:14:20.000Z","displayName":"neburevilo","preferences":"{\"usage\":\"public\"}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2020-06-29T14:05:03Z","updated":"2020-06-29T14:07:29Z","lastEventDate":"2020-06-29T14:07:29Z"},{"id":182990,"type":"PATENT","title":"2","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":49434,"tags":[],"user":{"id":320339875,"username":"tadro.abbott@csiro.au","firstName":"Tadro","lastName":"Abbott","created":"2019-06-27T07:11:33.000Z","displayName":"Tadro Abbott","preferences":"{\"usage\":\"public\"}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2020-08-10T01:50:08Z","updated":"2020-08-10T01:54:38Z","lastEventDate":"2020-08-10T01:54:38Z"},{"id":183532,"type":"PATENT","title":"Electricity - Ultra-Low-Cost Electricity Storage (Citing Patents)","description":"Patents citing scholarly works in Ultra-Low-Cost Electricity Storage","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":13809,"tags":[],"user":{"id":369423973,"username":"Lens Reports","firstName":"Lens","lastName":"Reports","created":"2020-09-16T23:25:18.000Z","displayName":"Lens Reports","profilePictureKey":"lens/avatar/00bf8c3d-2675-48ad-9d6e-5cf58c675620","avatar":{"id":1069,"key":"lens/avatar/00bf8c3d-2675-48ad-9d6e-5cf58c675620"},"preferences":"{\"beta\":true,\"usage\":\"public\"}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":true,"savedQueries":[{"id":50012,"title":"Ultra-Low-Cost Electricity Storage (Citing Patents)","queryId":"a2812ba4-c922-4815-87ed-8e1487fc0cc2"}],"created":"2020-09-21T01:12:10Z","updated":"2023-11-16T00:11:27Z","lastEventDate":"2023-11-16T00:11:27Z"},{"id":185688,"type":"PATENT","title":"Food Safety","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":50000,"tags":[],"user":{"id":379426745,"username":"guzmanbarcenas","firstName":"","lastName":"","created":"2020-11-27T23:02:26.000Z","displayName":"guzmanbarcenas","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2020-11-27T23:38:28Z","updated":"2020-11-27T23:40:39Z","lastEventDate":"2020-11-27T23:40:39Z"},{"id":185689,"type":"PATENT","title":"Food Safety and Management Systems","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":50000,"tags":[],"user":{"id":379426745,"username":"guzmanbarcenas","firstName":"","lastName":"","created":"2020-11-27T23:02:26.000Z","displayName":"guzmanbarcenas","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":true,"savedQueries":[],"created":"2020-11-27T23:43:53Z","updated":"2020-11-27T23:45:31Z","lastEventDate":"2020-11-27T23:45:31Z"},{"id":195131,"type":"PATENT","title":"Electrochemical Biosensors OR Biosensors AND Leukemia Diagnostics OR Leukemia","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":28822,"tags":[],"user":{"id":390700588,"username":"diegot","firstName":"Diego","lastName":"Triviño Bolaños","created":"2021-02-12T02:57:12.000Z","displayName":"Diego Triviño Bolaños","profilePictureKey":"lens/avatar/92b0de89-d77f-4973-b88a-4a0e06ac93e4","avatar":{"id":977,"key":"lens/avatar/92b0de89-d77f-4973-b88a-4a0e06ac93e4"},"preferences":"{}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":true,"savedQueries":[],"created":"2021-09-23T03:43:35Z","updated":"2024-03-28T02:26:34Z","lastEventDate":"2024-03-28T02:26:34Z"},{"id":208861,"type":"PATENT","title":"sarcopenia y nutricion","description":"tema relacionado con sarcopenia y uso de nutraceuticos","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":9715,"tags":[],"user":{"id":502976179,"username":"luisagil","firstName":"","lastName":"","created":"2023-04-14T21:38:42.000Z","displayName":"luisagil","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2023-04-14T21:51:45Z","updated":"2023-04-14T21:51:46Z","lastEventDate":"2023-04-14T21:51:46Z"},{"id":215576,"type":"PATENT","title":"US_Granted_Active_A61P","description":"","access":"OPEN_ACCESS","displayAvatar":true,"attested":false,"itemCount":50000,"tags":[],"user":{"id":416214387,"username":"pi3kakt","firstName":"Yu Ren","lastName":"Wang","created":"2021-08-15T09:18:15.000Z","displayName":"Yu Ren Wang","preferences":"{\"usage\":\"public\"}","accountType":"PERSONAL","isOauthOnly":false},"notes":[],"sharedType":"PUBLISHED","hasLinkedSavedQueries":false,"savedQueries":[],"created":"2023-12-12T09:26:41Z","updated":"2023-12-12T09:26:44Z","lastEventDate":"2023-12-12T09:26:44Z"}],"privateNotes":[],"landscapeCollections":[],"landscapeNotes":[]},"document":{"record_lens_id":"040-676-874-921-89X","lens_id":["040-676-874-921-89X","195-484-882-399-24X"],"doc_key":"US_9175076_B2_20151103","created":"2016-01-15T22:11:24.746","docdb_id":445777783,"lens_internal":{"earliest_lens_id_created_time":"2016-01-15T22:11:24.746","last_modified":"2024-03-25T04:05:59.513","legacy_pub_key":"US_9175076_B2","has_doc_lang":true,"has_biblio_lang":true,"has_all_title_lang":true,"has_all_abstract_lang":true,"has_all_claims_lang":true,"has_description_lang":true},"jurisdiction":"US","doc_number":"9175076","kind":"B2","date_published":"2015-11-03","year_published":2015,"ids":["US_9175076_B2","040-676-874-921-89X","195-484-882-399-24X","US_9175076_B2_20151103","US","9175076","B2","US9175076B2","US9175076","9175076B2"],"lang":"en","publication_type":"GRANTED_PATENT","application_reference":{"jurisdiction":"US","doc_number":"201314137415","kind":"A","date":"2013-12-20"},"priority_claim":[{"jurisdiction":"US","doc_number":"201314137415","kind":"A","date":"2013-12-20"},{"jurisdiction":"US","doc_number":"201361827325","kind":"P","date":"2013-05-24"},{"jurisdiction":"US","doc_number":"201261745508","kind":"P","date":"2012-12-21"}],"priority_claim.source":"DOCDB","earliest_priority_claim_date":"2012-12-21","title":{"en":[{"text":"Anti-GDF15 antibodies","lang":"en","source":"DOCDB","data_format":"DOCDBA"}]},"title_lang":["en"],"has_title":true,"applicant":[{"name":"AVEO PHARMACEUTICALS INC","residence":"US","sequence":1,"app_type":"applicant"}],"applicant_count":1,"has_applicant":true,"inventor":[{"name":"LERNER LORENA","residence":"US","sequence":1},{"name":"ABBOTT SANDRA","residence":"US","sequence":2},{"name":"BAI AILIN","residence":"US","sequence":3},{"name":"CHEN TING","residence":"US","sequence":4},{"name":"CHIU MARIA ISABEL","residence":"US","sequence":5},{"name":"LIU QING","residence":"US","sequence":6},{"name":"POLING LAURA","residence":"US","sequence":7},{"name":"TAO NIANJUN","residence":"US","sequence":8},{"name":"WEILER SOLLY","residence":"US","sequence":9},{"name":"WENG ZHIGANG","residence":"US","sequence":10},{"name":"WINSTON JR WILLIAM M","residence":"US","sequence":11},{"name":"GYURIS JENO","residence":"US","sequence":12}],"inventor_count":12,"has_inventor":true,"agent":[{"name":"Goodwin Procter LLP","sequence":1}],"agent_count":1,"has_agent":true,"owner":[{"name":"AVEO PHARMACEUTICALS INC","address":"650 E. KENDALL STREET, CAMBRIDGE, MASSACHUSETTS, 02142","sequence":6,"recorded_date":"2014-03-20","execution_date":"2014-01-27","is_current_owner":true}],"owner_count":1,"owner_all":[{"name":"AVEO PHARMACEUTICALS INC","address":"650 E. KENDALL STREET, CAMBRIDGE, MASSACHUSETTS, 02142","sequence":6,"recorded_date":"2014-03-20","execution_date":"2014-01-27","is_current_owner":true}],"owner_all_count":1,"has_owner":true,"primary_examiner":{"name":"Elizabeth C Kemmerer","department":"1646"},"has_examiner":true,"class_ipcr":[{"symbol":"C07K16/00","version_indicator":"2006-01-01","class_symbol_position":"F","class_value":"I","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":1},{"symbol":"A61K39/00","version_indicator":"2006-01-01","class_symbol_position":"L","class_value":"A","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":2},{"symbol":"C07K16/18","version_indicator":"2006-01-01","class_symbol_position":"L","class_value":"I","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":3},{"symbol":"C07K16/22","version_indicator":"2006-01-01","class_symbol_position":"L","class_value":"I","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":4},{"symbol":"C12N1/21","version_indicator":"2006-01-01","class_symbol_position":"L","class_value":"I","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":5},{"symbol":"C12N5/10","version_indicator":"2006-01-01","class_symbol_position":"L","class_value":"I","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":6},{"symbol":"C12N5/12","version_indicator":"2006-01-01","class_symbol_position":"L","class_value":"I","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":7},{"symbol":"C12N15/09","version_indicator":"2006-01-01","class_symbol_position":"L","class_value":"I","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":8},{"symbol":"C12N15/13","version_indicator":"2006-01-01","class_symbol_position":"L","class_value":"I","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":9},{"symbol":"C12N15/63","version_indicator":"2006-01-01","class_symbol_position":"L","class_value":"I","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":10},{"symbol":"C12N15/64","version_indicator":"2006-01-01","class_symbol_position":"L","class_value":"I","action_date":"2015-11-03","class_status":"B","class_data_source":"H","generating_office":"US","sequence":11}],"class_ipcr.first_symbol":"C07K16/00","class_ipcr.later_symbol":["A61K39/00","C07K16/18","C07K16/22","C12N1/21","C12N5/10","C12N5/12","C12N15/09","C12N15/13","C12N15/63","C12N15/64"],"class_ipcr.inv_symbol":["C07K16/00","C07K16/18","C07K16/22","C12N1/21","C12N5/10","C12N5/12","C12N15/09","C12N15/13","C12N15/63","C12N15/64"],"class_ipcr.add_symbol":["A61K39/00"],"class_ipcr.source":"DOCDB","class_cpc":[{"symbol":"A61K2039/505","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":1},{"symbol":"C07K2317/24","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":2},{"symbol":"C07K2317/76","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":3},{"symbol":"C07K2317/92","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":4},{"symbol":"C07K2319/30","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":5},{"symbol":"A61P3/02","version_indicator":"2018-01-01","class_symbol_position":"L","class_value":"I","action_date":"2019-05-07","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":6},{"symbol":"C07K16/22","version_indicator":"2013-01-01","class_symbol_position":"F","class_value":"I","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":7},{"symbol":"A61K45/06","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"I","action_date":"2016-03-24","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":8},{"symbol":"A61P35/00","version_indicator":"2018-01-01","class_symbol_position":"L","class_value":"A","action_date":"2020-05-15","class_status":"B","class_data_source":"H","generating_office":"EP","sequence":9},{"symbol":"A61K2039/505","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"US","sequence":10},{"symbol":"C07K2317/24","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"US","sequence":11},{"symbol":"C07K2317/76","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"US","sequence":12},{"symbol":"C07K2317/92","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"US","sequence":13},{"symbol":"C07K2319/30","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"US","sequence":14},{"symbol":"A61P3/02","version_indicator":"2018-01-01","class_symbol_position":"L","class_value":"I","action_date":"2019-10-11","class_status":"B","class_data_source":"H","generating_office":"US","sequence":15},{"symbol":"C12N15/10","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2022-08-23","class_status":"B","class_data_source":"H","generating_office":"US","sequence":16},{"symbol":"C12N15/63","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2022-08-23","class_status":"B","class_data_source":"H","generating_office":"US","sequence":17},{"symbol":"C12N5/10","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"A","action_date":"2022-08-23","class_status":"B","class_data_source":"H","generating_office":"US","sequence":18},{"symbol":"C07K16/22","version_indicator":"2013-01-01","class_symbol_position":"F","class_value":"I","action_date":"2014-03-06","class_status":"B","class_data_source":"H","generating_office":"US","sequence":19},{"symbol":"A61K39/3955","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"I","action_date":"2016-03-24","class_status":"B","class_data_source":"H","generating_office":"US","sequence":20},{"symbol":"A61K45/06","version_indicator":"2013-01-01","class_symbol_position":"L","class_value":"I","action_date":"2016-03-24","class_status":"B","class_data_source":"H","generating_office":"US","sequence":21}],"class_cpc_cset":[],"class_cpc.first_symbol":"C07K16/22","class_cpc.later_symbol":["A61K2039/505","C07K2317/24","C07K2317/76","C07K2317/92","C07K2319/30","A61P3/02","A61K45/06","A61P35/00","A61K2039/505","C07K2317/24","C07K2317/76","C07K2317/92","C07K2319/30","A61P3/02","C12N15/10","C12N15/63","C12N5/10","A61K39/3955","A61K45/06"],"class_cpc.inv_symbol":["A61P3/02","C07K16/22","A61K45/06","A61P3/02","C07K16/22","A61K39/3955","A61K45/06"],"class_cpc.add_symbol":["A61K2039/505","C07K2317/24","C07K2317/76","C07K2317/92","C07K2319/30","A61P35/00","A61K2039/505","C07K2317/24","C07K2317/76","C07K2317/92","C07K2319/30","C12N15/10","C12N15/63","C12N5/10"],"class_cpc.source":"DOCDB","class_national":[],"class_national.later_symbol":[],"reference_cited":[{"patent":{"num":1,"document_id":{"jurisdiction":"US","doc_number":"2011300548","kind":"A1","date":"2011-12-08","name":"LAMBRECHT STIJN [BE], et al"},"lens_id":"103-300-056-563-910","category":[],"us_category":[],"cited_phase":"SEA","rel_claims":[],"sequence":1}},{"patent":{"num":1,"document_id":{"jurisdiction":"US","doc_number":"5994102","kind":"A","date":"1999-11-30","name":"HUDSON PETER L [US], et al"},"lens_id":"098-344-835-675-255","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":1}},{"patent":{"num":2,"document_id":{"jurisdiction":"US","doc_number":"6051424","kind":"A","date":"2000-04-18","name":"KATO SEISHI [JP], et al"},"lens_id":"125-299-818-027-392","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":2}},{"patent":{"num":3,"document_id":{"jurisdiction":"US","doc_number":"6180602","kind":"B1","date":"2001-01-30","name":"KATO SEISHI [JP], et al"},"lens_id":"169-214-223-025-76X","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":3}},{"patent":{"num":4,"document_id":{"jurisdiction":"US","doc_number":"6420543","kind":"B1","date":"2002-07-16","name":"LEE SE-JIN [US], et al"},"lens_id":"168-958-611-642-562","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":4}},{"patent":{"num":5,"document_id":{"jurisdiction":"US","doc_number":"6465181","kind":"B2","date":"2002-10-15","name":"BILLING-MEDEL PATRICIA A [US], et al"},"lens_id":"160-590-468-686-955","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":5}},{"patent":{"num":6,"document_id":{"jurisdiction":"US","doc_number":"6500638","kind":"B2","date":"2002-12-31","name":"HUDSON PETER L [US], et al"},"lens_id":"048-987-061-054-425","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":6}},{"patent":{"num":7,"document_id":{"jurisdiction":"US","doc_number":"6521227","kind":"B1","date":"2003-02-18","name":"HUDSON PETER L [US], et al"},"lens_id":"189-148-029-852-887","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":7}},{"patent":{"num":8,"document_id":{"jurisdiction":"US","doc_number":"7157235","kind":"B2","date":"2007-01-02","name":"BREIT SAMUEL N [AU], et al"},"lens_id":"127-463-319-315-781","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":8}},{"patent":{"num":9,"document_id":{"jurisdiction":"US","doc_number":"7282351","kind":"B2","date":"2007-10-16","name":"HUDSON PETER L [US], et al"},"lens_id":"063-680-275-692-171","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":9}},{"patent":{"num":10,"document_id":{"jurisdiction":"US","doc_number":"7514221","kind":"B2","date":"2009-04-07","name":"BREIT SAMUEL NORBERT [AU], et al"},"lens_id":"031-570-408-792-697","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":10}},{"patent":{"num":11,"document_id":{"jurisdiction":"US","doc_number":"7741055","kind":"B2","date":"2010-06-22","name":"HUDSON PETER L [US], et al"},"lens_id":"102-254-844-664-754","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":11}},{"patent":{"num":12,"document_id":{"jurisdiction":"US","doc_number":"7919084","kind":"B2","date":"2011-04-05","name":"BREIT SAMUEL N [AU], et al"},"lens_id":"170-617-555-702-749","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":12}},{"patent":{"num":13,"document_id":{"jurisdiction":"US","doc_number":"7968303","kind":"B2","date":"2011-06-28","name":"BREIT SAMUEL NORBERT [AU], et al"},"lens_id":"175-333-325-590-152","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":13}},{"patent":{"num":14,"document_id":{"jurisdiction":"US","doc_number":"8173434","kind":"B2","date":"2012-05-08","name":"FAN RONG A [US], et al"},"lens_id":"110-906-370-756-171","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":14}},{"patent":{"num":15,"document_id":{"jurisdiction":"US","doc_number":"8192735","kind":"B2","date":"2012-06-05","name":"BREIT SAMUEL NORBERT [AU], et al"},"lens_id":"035-261-238-017-28X","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":15}},{"patent":{"num":16,"document_id":{"jurisdiction":"US","doc_number":"2007207462","kind":"A1","date":"2007-09-06","name":"ICHINOSE MASAKAZU [JP], et al"},"lens_id":"114-351-027-509-105","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":16}},{"patent":{"num":17,"document_id":{"jurisdiction":"US","doc_number":"2009021293","kind":"A1","date":"2009-01-22","name":"HEBERT GARY [US], et al"},"lens_id":"004-532-707-315-077","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":17}},{"patent":{"num":18,"document_id":{"jurisdiction":"US","doc_number":"2011033886","kind":"A1","date":"2011-02-10","name":"HESS GEORG [DE], et al"},"lens_id":"059-534-375-409-29X","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":18}},{"patent":{"num":19,"document_id":{"jurisdiction":"US","doc_number":"2011065204","kind":"A1","date":"2011-03-17","name":"WOLLERT KAI C [DE], et al"},"lens_id":"134-232-415-392-803","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":19}},{"patent":{"num":20,"document_id":{"jurisdiction":"US","doc_number":"2011262444","kind":"A1","date":"2011-10-27","name":"KIM HYESOOK [US]"},"lens_id":"179-889-609-242-79X","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":20}},{"patent":{"num":21,"document_id":{"jurisdiction":"US","doc_number":"2012083420","kind":"A1","date":"2012-04-05","name":"CLARK HILARY [US], et al"},"lens_id":"170-070-045-597-196","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":21}},{"patent":{"num":22,"document_id":{"jurisdiction":"CA","doc_number":"2534871","kind":"A1","date":"2007-08-15","name":"OHIO STATE RES FOUND [US]"},"lens_id":"165-722-134-308-704","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":22}},{"patent":{"num":23,"document_id":{"jurisdiction":"EP","doc_number":"2103943","kind":"A1","date":"2009-09-23","name":"HOFFMANN LA ROCHE [CH], et al"},"lens_id":"002-024-965-768-462","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":23}},{"patent":{"num":24,"document_id":{"jurisdiction":"WO","doc_number":"9403599","kind":"A1","date":"1994-02-17","name":"SAGAMI CHEM RES [JP], et al"},"lens_id":"196-324-622-048-009","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":24}},{"patent":{"num":25,"document_id":{"jurisdiction":"WO","doc_number":"9618730","kind":"A1","date":"1996-06-20","name":"HUMAN GENOME SCIENCES INC [US], et al"},"lens_id":"144-221-128-848-934","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":25}},{"patent":{"num":26,"document_id":{"jurisdiction":"WO","doc_number":"9700958","kind":"A1","date":"1997-01-09","name":"ST VINCENTS HOSP SYDNEY [AU], et al"},"lens_id":"139-852-147-252-298","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":26}},{"patent":{"num":27,"document_id":{"jurisdiction":"WO","doc_number":"9906445","kind":"A1","date":"1999-02-11","name":"UNIV JOHNS HOPKINS MED [US], et al"},"lens_id":"156-023-334-434-917","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":27}},{"patent":{"num":28,"document_id":{"jurisdiction":"WO","doc_number":"0020449","kind":"A2","date":"2000-04-13","name":"STRYKER CORP [US]"},"lens_id":"004-476-590-688-326","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":28}},{"patent":{"num":29,"document_id":{"jurisdiction":"WO","doc_number":"0056352","kind":"A2","date":"2000-09-28","name":"ABBOTT LAB [US]"},"lens_id":"097-729-040-803-103","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":29}},{"patent":{"num":30,"document_id":{"jurisdiction":"WO","doc_number":"0070051","kind":"A1","date":"2000-11-23","name":"BIOPH BIOTECH ENTW PHARM GMBH [DE], et al"},"lens_id":"119-024-505-446-166","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":30}},{"patent":{"num":31,"document_id":{"jurisdiction":"WO","doc_number":"0220759","kind":"A2","date":"2002-03-14","name":"US GOV HEALTH & HUMAN SERV [US], et al"},"lens_id":"078-177-038-576-106","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":31}},{"patent":{"num":32,"document_id":{"jurisdiction":"WO","doc_number":"2004043385","kind":"A2","date":"2004-05-27","name":"BARNES JEWISH HOSPITAL [US], et al"},"lens_id":"129-712-441-788-969","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":32}},{"patent":{"num":33,"document_id":{"jurisdiction":"WO","doc_number":"2005044990","kind":"A2","date":"2005-05-19","name":"BAYER HEALTHCARE LLC [US], et al"},"lens_id":"016-653-784-438-106","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":33}},{"patent":{"num":34,"document_id":{"jurisdiction":"WO","doc_number":"2009021293","kind":"A1","date":"2009-02-19","name":"ST VINCENTS HOSP SYDNEY [AU], et al"},"lens_id":"096-754-578-609-626","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":34}},{"patent":{"num":35,"document_id":{"jurisdiction":"WO","doc_number":"2009046495","kind":"A1","date":"2009-04-16","name":"ST VINCENTS HOSP SYDNEY [AU], et al"},"lens_id":"072-706-658-931-44X","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":35}},{"patent":{"num":36,"document_id":{"jurisdiction":"WO","doc_number":"2011117254","kind":"A1","date":"2011-09-29","name":"PROSIDION LTD [GB], et al"},"lens_id":"100-640-854-779-371","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":36}},{"patent":{"num":37,"document_id":{"jurisdiction":"WO","doc_number":"2012113103","kind":"A1","date":"2012-08-30","name":"HELSINN HEALTHCARE SA [CH], et al"},"lens_id":"040-631-566-127-222","category":[],"us_category":[],"cited_phase":"APP","rel_claims":[],"sequence":37}},{"npl":{"num":1,"text":"Allan et al., \"A selective androgen receptor modulator that reduces prostate tumor size and prevents orchidectomy-induced bone loss in rats.\" J Steroid Biochem Mol Biol. Jan. 2007;103(1):76-83.","npl_type":"a","external_id":["10.1016/j.jsbmb.2006.07.006","17049844"],"record_lens_id":"038-384-612-704-901","lens_id":["098-166-203-148-730","038-384-612-704-901","129-133-056-560-654"],"sequence":38,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":2,"text":"Argilés et al., \"Anti-inflammatory therapies in cancer cachexia.\" Eur J Pharmacol. Sep. 2011;668 Suppl 1:S81-6.","npl_type":"a","external_id":["10.1016/j.ejphar.2011.07.007","21835173"],"record_lens_id":"067-042-247-759-42X","lens_id":["076-347-960-833-289","085-242-507-334-647","067-042-247-759-42X"],"sequence":39,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":3,"text":"Bauerlein et al., \"Efficacy of REGN1033, a fully human anti-myostatin antagonist antibody, in rodent muscle function.\" J. Cachexia Sarcopenia Muscle 2013;4:295-343 Abstract 4-06 from 7th Cachexia Conference, Kobe/Osaka, Japan, Dec. 9-11, 2013.","npl_type":"a","external_id":["pmc3838509","24190182","10.1007/s13539-013-0123-9"],"record_lens_id":"005-657-279-775-573","lens_id":["114-699-123-659-266","005-657-279-775-573","197-732-376-496-525"],"sequence":40,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":4,"text":"Baumgartner et al., \"Epidemiology of sarcopenia among the elderly in New Mexico.\" Am J Epidemiol. Apr. 15, 1998;147(8):755-63.","npl_type":"a","external_id":["10.1093/oxfordjournals.aje.a009520","9554417"],"record_lens_id":"000-682-761-714-966","lens_id":["195-620-867-309-625","000-682-761-714-966","092-874-368-957-201"],"sequence":41,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":5,"text":"Bauskin et al., \"Role of macrophage inhibitory cytokine-1 in tumorigenesis and diagnosis of cancer.\" Cancer Res. May 15, 2006;66(10):4983-6.","npl_type":"a","external_id":["16707416","10.1158/0008-5472.can-05-4067"],"record_lens_id":"001-948-637-591-42X","lens_id":["068-159-442-594-486","001-948-637-591-42X","137-721-051-117-347"],"sequence":42,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":6,"text":"Bialek et al., \"A myostatin and activin decoy receptor enhances bone formation in mice.\" Bone. Mar. 2014; 60:162-171.","npl_type":"a","external_id":["10.1016/j.bone.2013.12.002","24333131"],"record_lens_id":"050-665-177-938-695","lens_id":["160-553-819-446-150","050-665-177-938-695","070-672-855-785-036"],"sequence":43,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":7,"text":"Bovee et al., \"SERMs and SARMs: detection of their activities with yeast based bioassays.\" J. Steroid Biochem. Mol. Biol. 2010;118:85-92.","npl_type":"a","external_id":["19883760","10.1016/j.jsbmb.2009.10.007"],"record_lens_id":"116-931-068-339-767","lens_id":["192-387-855-871-875","189-144-673-033-921","116-931-068-339-767"],"sequence":44,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":8,"text":"Breit et al. \"The TGF-beta superfamily cytokine, MIC-1/GDF15: a pleotrophic cytokine with roles in inflammation, cancer and metabolism\" Growth Factors. Oct. 2011;29(5):187-95.","npl_type":"a","external_id":["10.3109/08977194.2011.607137","21831009"],"record_lens_id":"006-370-135-623-851","lens_id":["174-163-105-744-185","040-111-075-516-267","006-370-135-623-851"],"sequence":45,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":9,"text":"Chen et al., \"Discovery and Therpeutic Promise of Selective Androgen Receptor Modulators.\" Mol. Interv. Jun. 2005; 5(3):173-188.","npl_type":"a","external_id":["10.1124/mi.5.3.7","pmc2072877","15994457"],"record_lens_id":"043-723-521-793-309","lens_id":["046-769-319-768-719","043-723-521-793-309","122-872-809-851-750"],"sequence":46,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":10,"text":"Dalton et al., \"The selective androgen receptor modulator GTx-024 (enobosarm) improves lean body mass and physical function in healthy elderly men and postmenopausal women: results of a double-blind, placebo-controlled phase II trial.\" J Cachexia Sarcopenia Muscle. Sep. 2011;2(3):153-161.","npl_type":"a","external_id":["10.1007/s13539-011-0034-6","pmc3177038","22031847"],"record_lens_id":"037-182-703-761-926","lens_id":["197-318-172-460-615","041-181-408-631-571","037-182-703-761-926"],"sequence":47,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":11,"text":"Davenport and Wright, \"Treating Obesity: is it all in the gut?\" Drug Discov Today (2013), .","npl_type":"a","external_id":["10.1016/j.drudis.2013.10.025","24291217"],"record_lens_id":"104-447-808-187-827","lens_id":["193-850-376-867-607","145-435-510-140-996","104-447-808-187-827"],"sequence":48,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":12,"text":"DeBoer and Marks, \"Cachexia: lessons from melanocortin antagonism.\" Trends Endocrinol Metab. Jul. 2006;17(5):199-204.","npl_type":"a","external_id":["16750633","10.1016/j.tem.2006.05.005"],"record_lens_id":"041-535-516-019-529","lens_id":["143-779-416-169-350","041-535-516-019-529","186-652-782-263-381"],"sequence":49,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":13,"text":"Enomoto et al., \"Suppression of cancer cachexia by 20S,21-epoxy-resibufogenin-3-acetate-a novel nonpeptide IL-6, receptor antagonist.\" Biochem Biophys Res Commun. Oct. 22, 2004;323(3):1096-102.","npl_type":"a","external_id":["10.1016/j.bbrc.2004.08.196","15381112"],"record_lens_id":"021-036-693-533-084","lens_id":["126-624-879-401-82X","021-036-693-533-084","066-074-516-859-729"],"sequence":50,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":14,"text":"Evans et al., \"Cachexia: a new definition.\" Clin Nutr. Dec. 2008;27(6):793-9.","npl_type":"a","external_id":["18718696","10.1016/j.clnu.2008.06.013"],"record_lens_id":"028-151-357-189-067","lens_id":["092-652-560-287-195","127-616-292-504-121","028-151-357-189-067"],"sequence":51,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":15,"text":"Fairlie et al., \"Expression of a TGF-beta superfamily protein, macrophage inhibitory cytokine-1, in the yeast Pichia pastoris.\" Gene. Aug. 22, 2000;254(1-2):67-76.","npl_type":"a","external_id":["10.1016/s0378-1119(00)00295-x","10974537"],"record_lens_id":"064-585-556-867-127","lens_id":["187-329-840-398-556","064-585-556-867-127","168-359-382-870-320"],"sequence":52,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":16,"text":"Fearon et al., \"Cancer cachexia: mediators, signaling, and metabolic pathways.\" Cell Metab. Aug. 8, 2012;16(2):153-66.","npl_type":"a","external_id":["22795476","10.1016/j.cmet.2012.06.011"],"record_lens_id":"025-829-794-555-130","lens_id":["030-290-642-327-58X","077-114-222-190-401","025-829-794-555-130"],"sequence":53,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":17,"text":"Fearon et al., \"Definition and classification of cancer cachexia: an international consensus.\" Lancet Oncol. May 2011;12(5):489-95.","npl_type":"a","external_id":["21296615","10.1016/s1470-2045(10)70218-7"],"record_lens_id":"009-277-950-485-275","lens_id":["113-997-713-754-449","018-174-300-900-013","009-277-950-485-275"],"sequence":54,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":18,"text":"Fong et al. \"Cachectin/TNF or IL-1 alpha induces cachexia with redistribution of body proteins.\" Am J Physiol. Mar. 1989;256(3 Pt 2):R659-65.","npl_type":"a","external_id":["10.1152/ajpregu.1989.256.3.r659","2784290"],"record_lens_id":"064-002-537-998-810","lens_id":["141-671-054-107-461","064-002-537-998-810","172-615-838-235-427"],"sequence":55,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":19,"text":"Glass, \"Signaling pathways perturbing muscle mass.\" Curr Opin Clin Nutr Metab Care. May 2010;13(3):225-9.","npl_type":"a","external_id":["10.1097/mco.0b013e32833862df","20397318"],"record_lens_id":"101-287-203-394-197","lens_id":["115-104-015-641-895","150-336-217-671-947","101-287-203-394-197"],"sequence":56,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":20,"text":"Guillory et al., \"Chapter 3: The Role of Ghrelin in Anorexia-Cachexia Syndromes.\" Vitamins and Hormones. 2013; 92:61-106.","npl_type":"a","external_id":["23601421","10.1016/b978-0-12-410473-0.00003-9"],"record_lens_id":"079-689-959-699-085","lens_id":["146-881-851-326-365","079-689-959-699-085","126-615-230-591-601"],"sequence":57,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":21,"text":"Hinoi et al. \"Positive regulation of osteoclastic differentiation by growth differentiation factor 15 upregulated in osteocytic cells under hypoxia\" J Bone Miner Res. Apr. 2012;27(4):938-49.","npl_type":"a","external_id":["22190281","10.1002/jbmr.1538"],"record_lens_id":"093-350-935-348-509","lens_id":["142-949-469-904-358","184-874-696-582-74X","093-350-935-348-509"],"sequence":58,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":22,"text":"Hryniewicz et al., Partial reversal of cachexia by beta-adrenergic receptor blocker therapy in patients with chronic heart failure. J Card Fail. Dec. 2003;9(6):464-8.","npl_type":"a","external_id":["10.1016/s1071-9164(03)00582-7","14966787"],"record_lens_id":"006-067-229-138-783","lens_id":["019-449-397-741-464","006-067-229-138-783","070-664-481-204-988"],"sequence":59,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":23,"text":"International Search Report and Written Opinion for International Application No. PCT/US2013/077139, mailed May 22, 2014, 20 pages.","npl_type":"a","external_id":[],"lens_id":[],"sequence":60,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":24,"text":"Inui, \"Cancer anorexia-cachexia syndrome: current issues in research and management.\" Cancer J Clin. Mar.-Apr. 2002;52(2):72-91.","npl_type":"a","external_id":["11929007","10.3322/canjclin.52.2.72"],"record_lens_id":"042-862-850-682-419","lens_id":["111-472-765-626-567","042-862-850-682-419","122-915-135-243-157"],"sequence":61,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":25,"text":"Johnen et al., \"Tumor-induced anorexia and weight loss are mediated by the TGF-beta superfamily cytokine MIC-1.\" Nat Med. Nov. 2007;13(11):1333-40.","npl_type":"a","external_id":["17982462","10.1038/nm1677"],"record_lens_id":"036-085-023-360-44X","lens_id":["058-545-908-576-419","036-085-023-360-44X","139-448-461-878-016"],"sequence":62,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":26,"text":"Joppa et al., \"Central infusion of the melanocortin receptor antagonist agouti-related peptide (AgRP(83-132)) prevents cachexia-related symptoms induced by radiation and colon-26 tumors in mice.\" Peptides. Mar. 2007;28(3):636-42.","npl_type":"a","external_id":["10.1016/j.peptides.2006.11.021","17204351"],"record_lens_id":"005-759-813-753-399","lens_id":["091-812-778-555-301","005-759-813-753-399","116-854-764-978-654"],"sequence":63,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":27,"text":"Lokireddy et al., \"Myostatin is a novel tumoral factor that induces cancer cachexia.\" Biochem J. Aug. 15, 2012;446(1):23-36.","npl_type":"a","external_id":["22621320","pmc3408049","10.1042/bj20112024"],"record_lens_id":"111-501-210-268-647","lens_id":["145-500-930-664-874","157-550-882-514-409","111-501-210-268-647"],"sequence":64,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":28,"text":"Marino et al., \"The therapeutic potential of blocking the activin signalling pathway.\" Cytokine Growth Factor Rev. Oct. 2013;24(5):477-84.","npl_type":"a","external_id":["10.1016/j.cytogfr.2013.04.006","23787160"],"record_lens_id":"131-896-075-962-381","lens_id":["181-751-450-033-450","131-896-075-962-381","138-945-832-048-304"],"sequence":65,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":29,"text":"Matthys and Billiau, \"Cytokines and cachexia.\" Nutrition. Sep. 1997;13(9):763-70.","npl_type":"a","external_id":["10.1016/s0899-9007(97)00185-8","9290087"],"record_lens_id":"017-172-189-391-146","lens_id":["041-154-823-468-982","017-172-189-391-146","168-027-194-220-485"],"sequence":66,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":30,"text":"Mohler et al., \"Nonsteroidal Selective Androgen Receptor Modulators (SARMs): Dissociating the Anabolic and Androgenic Activities of the Androgen Receptor for Therapeutic Benfit.\" J. Med. Chem. 2008;52(12):3597-3617.","npl_type":"a","external_id":["10.1021/jm900280m","19432422"],"record_lens_id":"068-037-867-797-152","lens_id":["161-728-869-481-366","152-607-511-332-57X","068-037-867-797-152"],"sequence":67,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":31,"text":"Muscaritoli et al., \"Consensus definition of sarcopenia, cachexia and pre-cachexia: joint document elaborated by Special Interest Groups (SIG) 'cachexia-anorexia in chronic wasting diseases' and 'nutrition in geriatrics.'\" Clin Nutr. Apr. 2010;29(2):154-9.","npl_type":"a","external_id":["20060626","10.1016/j.clnu.2009.12.004"],"record_lens_id":"011-692-457-770-291","lens_id":["070-748-937-181-891","024-479-255-212-020","011-692-457-770-291"],"sequence":68,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":32,"text":"Nagata et al., \"Design and synthesis of tricyclic tetrahydroquinolines as a new series of nonsteroidal selective androgen receptor modulators (SARMs).\" Bioorg. Med. Chem. Lett. 2011;21:1744-1747.","npl_type":"a","external_id":["21349712","10.1016/j.bmcl.2011.01.073"],"record_lens_id":"073-825-761-676-297","lens_id":["129-795-622-546-893","196-496-520-138-354","073-825-761-676-297"],"sequence":69,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":33,"text":"Ng et al., Synthesis of potent and tissue-selective androgen receptor modulators (SARMs): 2-(2,2,2)-Trifluoroethyl-benzimidazole scaffold. Bioorg Med Chem Lett. Mar. 15, 2007;17(6):1784-7.","npl_type":"a","external_id":["17197181","10.1016/j.bmcl.2006.12.045"],"record_lens_id":"012-468-243-229-395","lens_id":["050-591-651-674-107","012-468-243-229-395","114-301-358-454-449"],"sequence":70,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":34,"text":"Prado et al., \"Skeletal muscle anabolism is a side effect of therapy with the MEK inhibitor: selumetinib in patients with cholangiocarcinoma.\" Br J Cancer. May 8, 2012;106(10):1583-6.","npl_type":"a","external_id":["22510747","10.1038/bjc.2012.144","pmc3349178"],"record_lens_id":"001-811-120-392-121","lens_id":["199-175-398-083-16X","108-934-899-566-876","001-811-120-392-121"],"sequence":71,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":35,"text":"Roth et al. \"GDF-15 contributes to proliferation and immune escape of malignant gliomas\" Clin Cancer Res. Aug. 1, 2010;16(15):3851-9.","npl_type":"a","external_id":["10.1158/1078-0432.ccr-10-0705","20534737"],"record_lens_id":"044-685-443-411-118","lens_id":["059-758-970-150-836","080-353-884-721-490","044-685-443-411-118"],"sequence":72,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":36,"text":"Rüegg and Glass, \"Molecular mechanisms and treatment options for muscle wasting diseases.\" Annu Rev Pharmacol Toxicol. 2011;51:373-95.","npl_type":"a","external_id":["20936944","10.1146/annurev-pharmtox-010510-100537"],"record_lens_id":"078-310-341-284-632","lens_id":["112-497-658-918-30X","144-622-491-731-885","078-310-341-284-632"],"sequence":73,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":37,"text":"Sharma et al., \"Molecular targets of cancer cachexia: opportunities for pharmanutritional approaches.\" PharmaNutrition. 2013, .","npl_type":"a","external_id":["10.1016/j.phanu.2013.11.004"],"record_lens_id":"147-454-694-340-349","lens_id":["147-454-694-340-349","018-032-284-186-839"],"sequence":74,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":38,"text":"Steinman and DeBoer, \"Chapter 8: Treatment of Cachexia: Melanocortin and Ghrelin Interventions.\" Vitamins and Hormones. 2013; 92:197-240.","npl_type":"a","external_id":["23601426","10.1016/b978-0-12-410473-0.00008-8"],"record_lens_id":"072-717-664-344-923","lens_id":["080-392-891-290-504","072-717-664-344-923","088-377-005-826-147"],"sequence":75,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":39,"text":"Stewart-Coats et al., \"The ACT-ONE trial, a multicentre, randomised, double-blind, placebo-controlled, dose-finding study of the anabolic/catabolic transforming agent, MT-102 in subjects with cachexia related to stage III and IV non-small cell lung cancer and colorectal cancer:study design.\" J Cachexia Sarcopenia Muscle. Dec. 2011;2(4):201-207.","npl_type":"a","external_id":["10.1007/s13539-011-0046-2","22207908","pmc3222831"],"record_lens_id":"002-596-918-023-04X","lens_id":["069-331-938-785-508","168-170-081-667-186","002-596-918-023-04X"],"sequence":76,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":40,"text":"Strassmann et al., Mechanisms of experimental cancer cachexia. Local involvement of IL-1 in colon-26 tumor. J Immunol. Mar. 15, 1993;150(6):2341-5.","npl_type":"a","external_id":["8450216"],"record_lens_id":"000-286-558-985-803","lens_id":["141-350-524-707-414","000-286-558-985-803"],"sequence":77,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":41,"text":"Temel et al., \"Efficacy and safety results from a phase II study of anamorelin HCI, a ghrelin receptor agonist, in NSCLC patients.\" J. Cachexia Sarcopenia Muscle 2013;4:295-343 Abstract 5-01 from 7th Cachexia Conference, Kobe/Osaka, Japan, Dec. 9-11, 2013.","npl_type":"a","external_id":["pmc3838509","24190182","10.1007/s13539-013-0123-9"],"record_lens_id":"005-657-279-775-573","lens_id":["114-699-123-659-266","005-657-279-775-573","197-732-376-496-525"],"sequence":78,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":42,"text":"Thomas, \"Loss of skeletal muscle mass in aging: examining the relationship of starvation, sarcopenia and cachexia.\" Clin Nutr. Aug. 2007;26(4):389-99.","npl_type":"a","external_id":["17499396","10.1016/j.clnu.2007.03.008"],"record_lens_id":"069-137-634-715-851","lens_id":["120-971-930-486-530","069-137-634-715-851","087-494-969-058-193"],"sequence":79,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":43,"text":"Tisdale, \"Cachexia in cancer patients.\" Nat Rev Cancer. Nov. 2002;2(11):862-71.","npl_type":"a","external_id":["10.1038/nrc927","12415256"],"record_lens_id":"002-249-849-386-325","lens_id":["190-021-471-134-092","002-249-849-386-325","143-177-787-178-469"],"sequence":80,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":44,"text":"Tsai et al., \"Anorexia/cachexia of chronic diseases: a role for the TGF-beta family cytokine MIC-1/GDF15.\" J Cachexia Sarcopenia Muscle. Dec. 2012;3(4):239-43.","npl_type":"a","external_id":["pmc3505580","10.1007/s13539-012-0082-6","22936174"],"record_lens_id":"133-663-884-970-088","lens_id":["170-751-849-224-014","139-146-314-616-135","133-663-884-970-088"],"sequence":81,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":45,"text":"Tuca et al., \"Clinical evaluation and optimal management of cancer cachexia.\" Crit Rev Oncol Hematol. Dec. 2013;88(3):625-36.","npl_type":"a","external_id":["10.1016/j.critrevonc.2013.07.015","23953794"],"record_lens_id":"003-354-826-302-628","lens_id":["074-957-221-544-227","003-354-826-302-628","039-897-278-631-38X"],"sequence":82,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":46,"text":"Zhang et al., \"Serendipitous discovery of novel imidazolopyrazole scaffold as selective androgen receptor modulators.\" Bioorg Med Chem Lett. Jan. 15, 2007;17(2):439-43.","npl_type":"a","external_id":["10.1016/j.bmcl.2006.10.035","17079140"],"record_lens_id":"027-492-919-572-615","lens_id":["123-485-542-594-199","027-492-919-572-615","065-997-560-846-449"],"sequence":83,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":47,"text":"Zhang et al., \"Synthesis and SAR of novel hydantoin derivatives as selective androgen receptor modulators.\" Bioorg Med Chem Lett. Nov. 15, 2006;16(22):5763-6.","npl_type":"a","external_id":["16959487","10.1016/j.bmcl.2006.08.084"],"record_lens_id":"076-935-055-244-522","lens_id":["117-654-603-968-615","076-935-055-244-522","117-726-691-381-282"],"sequence":84,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}},{"npl":{"num":48,"text":"Zhou et al., \"Reversal of cancer cachexia and muscle wasting by ActRIIB antagonism leads to prolonged survival.\" Cell. Aug. 20, 2010;142(4):531-43.","npl_type":"a","external_id":["10.1016/j.cell.2010.07.011","20723755"],"record_lens_id":"027-457-437-723-560","lens_id":["157-479-937-018-893","110-877-790-756-215","027-457-437-723-560"],"sequence":85,"category":[],"us_category":[],"cited_phase":"APP","rel_claims":[]}}],"reference_cited.source":"DOCDB","reference_cited.patent_count":38,"cites_patent":true,"reference_cited.npl_count":48,"reference_cited.npl_resolved_count":47,"cites_npl":true,"cites_resolved_npl":true,"cited_by":{"patent_count":13,"patent":[{"lens_id":"153-442-159-859-682","document_id":{"jurisdiction":"WO","doc_number":"2023018803","kind":"A1"}},{"lens_id":"033-616-101-670-285","document_id":{"jurisdiction":"US","doc_number":"11897948","kind":"B2"}},{"lens_id":"083-709-078-181-489","document_id":{"jurisdiction":"US","doc_number":"10786576","kind":"B2"}},{"lens_id":"130-433-219-658-841","document_id":{"jurisdiction":"US","doc_number":"10597444","kind":"B2"}},{"lens_id":"087-420-791-331-532","document_id":{"jurisdiction":"WO","doc_number":"2023122213","kind":"A1"}},{"lens_id":"057-998-750-691-534","document_id":{"jurisdiction":"US","doc_number":"9725505","kind":"B2"}},{"lens_id":"128-381-696-789-787","document_id":{"jurisdiction":"US","doc_number":"10588980","kind":"B2"}},{"lens_id":"162-630-404-881-686","document_id":{"jurisdiction":"US","doc_number":"11406665","kind":"B2"}},{"lens_id":"092-209-595-747-52X","document_id":{"jurisdiction":"US","doc_number":"11752211","kind":"B2"}},{"lens_id":"128-806-194-732-888","document_id":{"jurisdiction":"US","doc_number":"11725047","kind":"B2"}},{"lens_id":"157-894-693-843-35X","document_id":{"jurisdiction":"US","doc_number":"20180142013","kind":"A1"}},{"lens_id":"031-733-039-743-729","document_id":{"jurisdiction":"US","doc_number":"20180282403","kind":"A1"}},{"lens_id":"070-763-642-095-182","document_id":{"jurisdiction":"US","doc_number":"20210101968","kind":"A1"}}]},"cited_by_patent":true,"family":{"simple":{"size":33,"id":184105523,"member":[{"lens_id":"126-619-816-966-827","document_id":{"jurisdiction":"AU","doc_number":"2013364133","kind":"B2","date":"2018-10-11"}},{"lens_id":"070-763-642-095-182","document_id":{"jurisdiction":"US","doc_number":"20210101968","kind":"A1","date":"2021-04-08"}},{"lens_id":"182-544-477-803-245","document_id":{"jurisdiction":"HK","doc_number":"1215670","kind":"A1","date":"2016-09-09"}},{"lens_id":"095-273-249-794-88X","document_id":{"jurisdiction":"JP","doc_number":"2021061864","kind":"A","date":"2021-04-22"}},{"lens_id":"169-206-806-046-044","document_id":{"jurisdiction":"JP","doc_number":"6758832","kind":"B2","date":"2020-09-30"}},{"lens_id":"142-328-697-627-67X","document_id":{"jurisdiction":"BR","doc_number":"112015014768","kind":"A2","date":"2017-10-10"}},{"lens_id":"184-861-696-910-085","document_id":{"jurisdiction":"AU","doc_number":"2013364133","kind":"A1","date":"2015-07-16"}},{"lens_id":"184-589-180-076-253","document_id":{"jurisdiction":"EP","doc_number":"2934584","kind":"B1","date":"2020-02-19"}},{"lens_id":"039-183-750-650-484","document_id":{"jurisdiction":"DK","doc_number":"2934584","kind":"T3","date":"2020-05-18"}},{"lens_id":"176-196-452-107-053","document_id":{"jurisdiction":"JP","doc_number":"2019056018","kind":"A","date":"2019-04-11"}},{"lens_id":"148-766-113-851-909","document_id":{"jurisdiction":"CN","doc_number":"105073133","kind":"B","date":"2021-04-20"}},{"lens_id":"196-572-482-603-295","document_id":{"jurisdiction":"MX","doc_number":"370720","kind":"B","date":"2019-12-20"}},{"lens_id":"057-998-750-691-534","document_id":{"jurisdiction":"US","doc_number":"9725505","kind":"B2","date":"2017-08-08"}},{"lens_id":"092-285-840-455-374","document_id":{"jurisdiction":"CN","doc_number":"105073133","kind":"A","date":"2015-11-18"}},{"lens_id":"181-575-890-486-138","document_id":{"jurisdiction":"EP","doc_number":"2934584","kind":"A1","date":"2015-10-28"}},{"lens_id":"169-173-554-611-853","document_id":{"jurisdiction":"EA","doc_number":"201591198","kind":"A1","date":"2015-11-30"}},{"lens_id":"055-251-207-228-750","document_id":{"jurisdiction":"EA","doc_number":"038645","kind":"B1","date":"2021-09-28"}},{"lens_id":"128-806-194-732-888","document_id":{"jurisdiction":"US","doc_number":"11725047","kind":"B2","date":"2023-08-15"}},{"lens_id":"158-434-287-925-690","document_id":{"jurisdiction":"WO","doc_number":"2014100689","kind":"A1","date":"2014-06-26"}},{"lens_id":"045-640-148-486-528","document_id":{"jurisdiction":"US","doc_number":"20140193427","kind":"A1","date":"2014-07-10"}},{"lens_id":"176-326-396-376-349","document_id":{"jurisdiction":"CA","doc_number":"2896076","kind":"C","date":"2022-12-06"}},{"lens_id":"179-270-657-807-354","document_id":{"jurisdiction":"EP","doc_number":"3689370","kind":"A1","date":"2020-08-05"}},{"lens_id":"112-010-714-184-578","document_id":{"jurisdiction":"ES","doc_number":"2791183","kind":"T3","date":"2020-11-03"}},{"lens_id":"040-676-874-921-89X","document_id":{"jurisdiction":"US","doc_number":"9175076","kind":"B2","date":"2015-11-03"}},{"lens_id":"053-999-418-571-951","document_id":{"jurisdiction":"KR","doc_number":"102208861","kind":"B1","date":"2021-01-27"}},{"lens_id":"117-689-899-817-604","document_id":{"jurisdiction":"KR","doc_number":"20150100837","kind":"A","date":"2015-09-02"}},{"lens_id":"109-646-867-040-677","document_id":{"jurisdiction":"CA","doc_number":"2896076","kind":"A1","date":"2014-06-26"}},{"lens_id":"045-436-705-237-834","document_id":{"jurisdiction":"US","doc_number":"20160083465","kind":"A1","date":"2016-03-24"}},{"lens_id":"156-052-217-801-389","document_id":{"jurisdiction":"MX","doc_number":"2015007751","kind":"A","date":"2015-11-30"}},{"lens_id":"118-662-603-249-764","document_id":{"jurisdiction":"AR","doc_number":"094271","kind":"A1","date":"2015-07-22"}},{"lens_id":"157-894-693-843-35X","document_id":{"jurisdiction":"US","doc_number":"20180142013","kind":"A1","date":"2018-05-24"}},{"lens_id":"183-770-639-024-116","document_id":{"jurisdiction":"JP","doc_number":"2016508984","kind":"A","date":"2016-03-24"}},{"lens_id":"130-433-219-658-841","document_id":{"jurisdiction":"US","doc_number":"10597444","kind":"B2","date":"2020-03-24"}}]},"extended":{"size":33,"id":184102552,"member":[{"lens_id":"126-619-816-966-827","document_id":{"jurisdiction":"AU","doc_number":"2013364133","kind":"B2","date":"2018-10-11"}},{"lens_id":"070-763-642-095-182","document_id":{"jurisdiction":"US","doc_number":"20210101968","kind":"A1","date":"2021-04-08"}},{"lens_id":"182-544-477-803-245","document_id":{"jurisdiction":"HK","doc_number":"1215670","kind":"A1","date":"2016-09-09"}},{"lens_id":"095-273-249-794-88X","document_id":{"jurisdiction":"JP","doc_number":"2021061864","kind":"A","date":"2021-04-22"}},{"lens_id":"169-206-806-046-044","document_id":{"jurisdiction":"JP","doc_number":"6758832","kind":"B2","date":"2020-09-30"}},{"lens_id":"142-328-697-627-67X","document_id":{"jurisdiction":"BR","doc_number":"112015014768","kind":"A2","date":"2017-10-10"}},{"lens_id":"184-589-180-076-253","document_id":{"jurisdiction":"EP","doc_number":"2934584","kind":"B1","date":"2020-02-19"}},{"lens_id":"184-861-696-910-085","document_id":{"jurisdiction":"AU","doc_number":"2013364133","kind":"A1","date":"2015-07-16"}},{"lens_id":"039-183-750-650-484","document_id":{"jurisdiction":"DK","doc_number":"2934584","kind":"T3","date":"2020-05-18"}},{"lens_id":"176-196-452-107-053","document_id":{"jurisdiction":"JP","doc_number":"2019056018","kind":"A","date":"2019-04-11"}},{"lens_id":"148-766-113-851-909","document_id":{"jurisdiction":"CN","doc_number":"105073133","kind":"B","date":"2021-04-20"}},{"lens_id":"196-572-482-603-295","document_id":{"jurisdiction":"MX","doc_number":"370720","kind":"B","date":"2019-12-20"}},{"lens_id":"057-998-750-691-534","document_id":{"jurisdiction":"US","doc_number":"9725505","kind":"B2","date":"2017-08-08"}},{"lens_id":"181-575-890-486-138","document_id":{"jurisdiction":"EP","doc_number":"2934584","kind":"A1","date":"2015-10-28"}},{"lens_id":"169-173-554-611-853","document_id":{"jurisdiction":"EA","doc_number":"201591198","kind":"A1","date":"2015-11-30"}},{"lens_id":"128-806-194-732-888","document_id":{"jurisdiction":"US","doc_number":"11725047","kind":"B2","date":"2023-08-15"}},{"lens_id":"055-251-207-228-750","document_id":{"jurisdiction":"EA","doc_number":"038645","kind":"B1","date":"2021-09-28"}},{"lens_id":"092-285-840-455-374","document_id":{"jurisdiction":"CN","doc_number":"105073133","kind":"A","date":"2015-11-18"}},{"lens_id":"158-434-287-925-690","document_id":{"jurisdiction":"WO","doc_number":"2014100689","kind":"A1","date":"2014-06-26"}},{"lens_id":"045-640-148-486-528","document_id":{"jurisdiction":"US","doc_number":"20140193427","kind":"A1","date":"2014-07-10"}},{"lens_id":"176-326-396-376-349","document_id":{"jurisdiction":"CA","doc_number":"2896076","kind":"C","date":"2022-12-06"}},{"lens_id":"179-270-657-807-354","document_id":{"jurisdiction":"EP","doc_number":"3689370","kind":"A1","date":"2020-08-05"}},{"lens_id":"112-010-714-184-578","document_id":{"jurisdiction":"ES","doc_number":"2791183","kind":"T3","date":"2020-11-03"}},{"lens_id":"040-676-874-921-89X","document_id":{"jurisdiction":"US","doc_number":"9175076","kind":"B2","date":"2015-11-03"}},{"lens_id":"053-999-418-571-951","document_id":{"jurisdiction":"KR","doc_number":"102208861","kind":"B1","date":"2021-01-27"}},{"lens_id":"157-894-693-843-35X","document_id":{"jurisdiction":"US","doc_number":"20180142013","kind":"A1","date":"2018-05-24"}},{"lens_id":"109-646-867-040-677","document_id":{"jurisdiction":"CA","doc_number":"2896076","kind":"A1","date":"2014-06-26"}},{"lens_id":"045-436-705-237-834","document_id":{"jurisdiction":"US","doc_number":"20160083465","kind":"A1","date":"2016-03-24"}},{"lens_id":"156-052-217-801-389","document_id":{"jurisdiction":"MX","doc_number":"2015007751","kind":"A","date":"2015-11-30"}},{"lens_id":"117-689-899-817-604","document_id":{"jurisdiction":"KR","doc_number":"20150100837","kind":"A","date":"2015-09-02"}},{"lens_id":"118-662-603-249-764","document_id":{"jurisdiction":"AR","doc_number":"094271","kind":"A1","date":"2015-07-22"}},{"lens_id":"183-770-639-024-116","document_id":{"jurisdiction":"JP","doc_number":"2016508984","kind":"A","date":"2016-03-24"}},{"lens_id":"130-433-219-658-841","document_id":{"jurisdiction":"US","doc_number":"10597444","kind":"B2","date":"2020-03-24"}}]}},"sequence":{"seq_list_key":"US_9175076_B2","type":["N","P"],"length_bucket":["NT_1_100","AA_301","AA_51_300","NT_101_5000","AA_1_50"],"length":[642,1026,4,5,6,7,8,9,10,11,1035,13,654,15,16,17,18,21,22,23,27,45,1326,1329,1332,1335,442,443,444,445,321,449,450,1347,324,1350,456,330,972,333,336,214,342,1368,344,345,218,990,350,354,357,360,363,107,111,1008,118,119,120,121],"organism":[{"name":"Homo sapiens","tax_id":9606},{"name":"Mus sp.","tax_id":10095},{"name":"Unknown/Artificial","tax_id":-1}],"document_location":["DDESC","CLAIM"],"count":266,"data_source":["USPTO_FULLTEXT_RB"]},"has_sequence":true,"legal_status":{"ipr_type":"patent for invention","granted":true,"earliest_filing_date":"2013-12-20","grant_date":"2015-11-03","anticipated_term_date":"2033-12-20","has_disclaimer":false,"patent_status":"ACTIVE","publication_count":2,"has_spc":false,"has_grant_event":true,"has_entry_into_national_phase":false},"abstract":{"en":[{"text":"Monoclonal antibodies that bind and inhibit the activity of human GDF15 are disclosed. The antibodies can be used to treat body weight loss, including cachexia, associated with the over-expression of human GDF15.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"}]},"abstract_lang":["en"],"has_abstract":true,"claim":{"en":[{"text":"1. An isolated antibody that binds human GDF15 comprising an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region selected from the group consisting of: (a) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:38 (Hu01G06 IGHV1-18 F2), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:237 and SEQ ID NO:241 (Hu01G06 IGHV1-18 F2), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-18 F2); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2); (b) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F1), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:238 and SEQ ID NO:241 (Hu01G06 IGHV1-69 F1), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F1); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1); (c) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-69 T3OS I69L), a CDR H2 comprising the amino acid sequence of SEQ ID NO:7 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-69 T30S I69L), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-69 T30S I69L); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I); (d) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:2 (03G05), a CDR H2 comprising the amino acid sequence of SEQ ID NO:8 (03G05), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:16 (03G05); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:22 (03G05), a CDR L2 comprising the amino acid sequence of SEQ ID NO:27 (03G05), and a CDR L3 comprising the amino acid sequence of SEQ ID NO 33 (03G05); (e) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:3 (04F08), a CDR H2 comprising the amino acid sequence of SEQ ID NO:9 (04F08), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:17 (04F08); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (04F08), a CDR L2 comprising the amino acid sequence of SEQ ID NO:28 (04F08), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:34 (04F08); (f) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:4 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), a CDR H2 comprising the amino acid sequence of SEQ ID NO:9 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:18 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), a CDR L2 comprising the amino acid sequence of SEQ ID NO:28 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:35 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16); (g) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (08G01), a CDR H2 comprising the amino acid sequence of SEQ ID NO:10 (08G01), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (08G01); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:24 (08G01), a CDR L2 comprising the amino acid sequence of SEQ ID NO:29 (08G01), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (08G01); (h) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:5 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), a CDR H2 comprising the amino acid sequence of SEQ ID NO:11 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:19 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), a CDR L2 comprising the amino acid sequence of SEQ ID NO:30 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:36 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16); (i) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:6 (17B11), a CDR H2 comprising the amino acid sequence of SEQ ID NO:12 (17B11), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:20 (17B11); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:25 (17B11), a CDR L2 comprising the amino acid sequence of SEQ ID NO:31 (17B11), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:37 (17B11); (j) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L), a CDR H2 comprising the amino acid sequence of SEQ ID NO:13 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I); (k) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:38 (Hu01G06 IGHV1-18 F1), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:236 and SEQ ID NO:240 (Hu01G06 IGHV1-18 F1), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-18 F1); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1); (l) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F2), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:239 and SEQ ID NO:240 (Hu01G06 IGHV1-69 F2), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F2); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1); (m) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F2), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:239 and SEQ ID NO:240 (Hu01G06 IGHV1-69 F2), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F2); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2); (n) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:4 (HE LM 06C11 IGHV2-70), a CDR H2 comprising the amino acid sequence of SEQ ID NO:14 (HE LM 06C11 IGHV2-70), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:18 (HE LM 06C11 IGHV2-70); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (Ch06C11 Chimeric, Sh06C11 IGKV1-16), a CDR L2 comprising the amino acid sequence of SEQ ID NO:28 (Ch06C11 Chimeric, Sh06C11 IGKV1-16), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:35 (Ch06C11 Chimeric, Sh06C11 IGKV1-16); (o) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:4 (Ch06C11 Chimeric), a CDR H2 comprising the amino acid sequence of SEQ ID NO:9 (Ch06C11 Chimeric), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:18 (Ch06C11 Chimeric); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (Ch14F11 Chimeric), a CDR L2 comprising the amino acid sequence of SEQ ID NO:30 (Ch14F11 Chimeric), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:36 (Ch14F11 Chimeric); and (p) (i) an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:5 (Ch14F11 Chimeric), a CDR H2 comprising the amino acid sequence of SEQ ID NO:11 (Ch14F11 Chimeric), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:19 (Ch14F11 Chimeric); and (ii) an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (Ch06C11 Chimeric), a CDR L2 comprising the amino acid sequence of SEQ ID NO:28 (Ch06C11 Chimeric), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:35 (Ch06C11 Chimeric).","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"2. The antibody of claim 1 , wherein the CDR sequences are interposed between human or humanized framework sequences.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"3. An isolated nucleic acid comprising a nucleotide sequence encoding an immunoglobulin heavy chain variable region of claim 1 .","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"4. An isolated nucleic acid comprising a nucleotide sequence encoding an immunoglobulin light chain variable region of claim 1 .","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"5. An expression vector comprising the nucleic acid of claim 3 .","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"6. An expression vector comprising the nucleic acid of claim 4 .","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"7. A host cell comprising the expression vector of claim 5 .","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"8. A host cell comprising the expression vector of claim 6 .","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"9. A method of producing a polypeptide comprising an immunoglobulin heavy chain variable region or an immunoglobulin light chain variable region, the method comprising: (a) growing the host cell of claim 8 under conditions so that the host cell expresses the polypeptide comprising the immunoglobulin heavy chain variable region or the immunoglobulin light chain variable region; and (b) purifying the polypeptide comprising the immunoglobulin heavy chain variable region or the immunoglobulin light chain variable region.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"10. An isolated antibody that binds human GDF15, comprising an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region selected from the group consisting of: (a) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2); (b) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1); (c) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (01G06, Ch01G06 Chimeric); (d) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:42 (03G05), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:78 (03G05); (e) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:44 (04F08), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:80 (04F08); (f) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (06C11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (06C11); (g) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:48 (08G01), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:84 (08G01); (h) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (14F11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (14F11); (i) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:52 (17B11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:88 (17B11); (j) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (k) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (l) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (m) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (n) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (o) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (p) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric); (q) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (r) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (s) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (t) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (u) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (v) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (w) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (x) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39); (y) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (z) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (aa) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (bb) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (cc) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (dd) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (ee) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (ff) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I); (gg) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (hh) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (ii) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (jj) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (kk) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (ll) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (mm) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (nn) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I); (oo) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1); (pp) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1); (qq) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2); (rr) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:68 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric); (ss) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:70 (Hu06C11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric); (tt) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (Ch06C11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16); (uu) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:68 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16); (vv) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:70 (Hu06C11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16); (ww) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:72 (Sh14F11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric); (xx) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric); (yy) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (Ch14F11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16); (zz) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:72 (Sh14F11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16); and (aaa) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16).","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"},{"text":"11. An isolated antibody that binds human GDF15 comprising an immunoglobulin heavy chain and an immunoglobulin light chain selected from the group consisting of: (a) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:258 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:264 (Hu01G06 IGKV1-39 F2); (b) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:260 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1); (c) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:176 (Ch01G06 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:204 (Ch01G06 Chimeric); (d) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:192 (Ch06C11 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:212 (Ch06C11 Chimeric); (e) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:198 (Ch14F11 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:216 (Ch14F11 Chimeric); (f) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:178 (Hu01G06 IGHV1-18), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39); (g) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:180 (Hu01G06 IGHV1-69), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39); (h) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I); (i) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I); (j) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I); (k) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I); (l) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:256 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1); (m) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1); (n) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:264 (Hu01G06 IGKV1-39 F2); (o) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:194 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:214 (Sh06C11 IGKV1-16); (p) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:196 (Hu06C11 IGHV2-5), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:214 (Sh06C11 IGKV1-16); (q) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:200 (Sh14F11 IGHV2-5), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:218 (Hu14F11 IGKV1-16); and (r) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:202 (Sh14F11 IGHV2-70), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:218 (Hu14F11 IGKV1-16).","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"}]},"claim_lang":["en"],"has_claim":true,"description":{"en":{"text":"CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of and priority to U.S. Provisional Patent Application No. 61/827,325, filed May 24, 2013, and U.S. Provisional Patent Application No. 61/745,508, filed Dec. 21, 2012, the entire disclosure of each of which is incorporated by reference herein in its entirety. FIELD OF THE INVENTION The field of the invention is molecular biology, immunology, cachexia and cachexia-like disorders, and oncology. More particularly, the field is therapeutic antibodies. BACKGROUND Involuntary weight loss can be categorized into three primary etiologies that include, cachexia, sarcopenia and starvation. Cachexia is a debilitating metabolic syndrome associated with numerous diseases, including cancer, AIDS, chronic heart failure (also known as congestive heart failure), chronic obstructive pulmonary disease (COPD), chronic kidney disease, tuberculosis, sepsis and other forms of systemic inflammation. Cachexia varies in its manifestations, but generally involves involuntary loss of skeletal muscle mass and some form of underlying illness (Evans et al. (2008) C LIN . N UTR . 27:793-799). Cachexia is a wasting disorder involving involuntary weight loss and may be associated with systemic inflammation and/or an acute inflammatory response. Thomas (2007) C LIN . N UTRITION 26:389-399. Loss of fat mass as well as fat-free mass, such as muscle mass, often is a prominent clinical feature of cachexia. In many but not all cases, cachexia progresses through stages that have been designated precachexia, cachexia and refractory cachexia (Fearon et al. (2011) L ANCET O NC . 12:489-495). Two different, but sometimes overlapping, processes appear to drive the development and progression of cachexia: (a) metabolic processes that act directly on muscle, reducing its mass and function; and (b) reduced food intake, which leads to loss of both fat and Muscle (Tsai et al. (2012) J. C ACHEXIA S ARCOPENIA M USCLE 3:239-243). Although cachexia is a complex and incompletely understood syndrome, it is clear that GDF15 (also known as MIC-1, PLAB, PDF and NAG-1), a member of the TGF-β superfamily, is an important mediator of cachexia in various diseases (Tsai et al., supra). At least some tumors over-express and secrete GDF15, and elevated serum GDF15 levels have been associated with various cancers (Johnen et al. (2007) N AT . M ED . 13:1333-1340; Bauskin et al. (2006) C ANCER R ES . 66:4983-4986). Monoclonal antibodies against GDF15 have been recognized as potential anti-cachexia therapeutic agents. See, e.g., U.S. Pat. No. 8,192,735. Weight loss resulting from cachexia is associated with poor prognosis in various diseases (Evans et al., supra), and cachexia and its consequences are considered to be the direct cause of death in about 20% of cancer deaths (Tisdale (2002) N AT . R EV . C ANCER 2:862-871). Cachexia is infrequently reversed by nutritional intervention, and currently this syndrome is seldom treated with drug therapy (Evans et al., supra). Sarcopenia is a clinical condition related to cachexia that is characterized by loss of skeletal muscle mass and muscle strength. The decrease in muscle mass can lead to functional impairment, with loss of strength, increased likelihood of falls, and loss of autonomy. Respiratory function may also be impaired with a reduced vital capacity. During metabolic stress, muscle protein is rapidly mobilized in order to provide the immune system, liver and gut with amino acids, particularly glutamine. Sarcopenia often is a disease of the elderly; however, its development may also be associated with muscle disuse and malnutrition, and may coincide with cachexia. Sarcopenia can be diagnosed based upon functional observations such as low muscle weight and low gait speed. See, e.g., Muscaritoli et al. (2010) C LIN . N UTRITION 29:154-159. Starvation typically results in a loss of body fat and non-fat mass due to inadequate diet and/or nutritional uptake (Thomas (2007) supra). The effects of starvation often are reversed by improving diet and nutritional, for example, protein, uptake. Naturally occurring antibodies are multimeric proteins that contain four polypeptide chains ( FIG. 1 ). Two of the polypeptide chains are called heavy chains (H chains), and two of the polypeptide chains are called light chains (L chains). The immunoglobulin heavy and light chains are connected by an interchain disulfide bond. The immunoglobulin heavy chains are connected by interchain disulfide bonds. A light chain consists of one variable region (V L in FIG. 1 ) and one constant region (C L in FIG. 1 ). The heavy chain consists of one variable region (V H in FIG. 1 ) and at least three constant regions (C H1 , C H2 and C H3 in FIG. 1 ). The variable regions determine the specificity of the antibody. Each variable region comprises three hypervariable regions also known as complementarity determining regions (CDRs) flanked by four relatively conserved framework regions (FRs). The three CDRs, referred to as CDR 1 , CDR 2 , and CDR 3 , contribute to the antibody binding specificity. Naturally occurring antibodies have been used as starting material for engineered antibodies, such as chimeric antibodies and humanized antibodies. There is a significant unmet need for effective therapeutic agents for treating cachexia and sarcopenia, including monoclonal antibodies targeting GDF15. Such therapeutic agents have the potential to play an important role in the treatment of various cancers and other life-threatening diseases. SUMMARY The invention is based, in part, upon the discovery of a family of antibodies that specifically bind human GDF15 (hGDF15). The antibodies contain hGDF15 binding sites based on the CDRs of the antibodies. The antibodies can be used as therapeutic agents. When used as therapeutic agents, the antibodies are engineered, e.g., humanized, to reduce or eliminate an immune response when administered to a human patient. The disclosed antibodies prevent or inhibit the activity of (i.e., neutralize) hGDF15. When administered to a mammal, the antibodies can inhibit the loss of muscle mass, for example, the loss of muscle mass associated with an underlying disease. The underlying disease may be selected from the group consisting of cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis. In some embodiments, the loss of muscle mass may be accompanied by a loss of fat mass. The disclosed antibodies can also be used to inhibit involuntary weight loss in a mammal. In some embodiments, the disclosed antibodies may also be used to inhibit the loss of organ mass. Further, a method of treating cachexia and/or sarcopenia in a mammal comprising administering an effective amount of one of at least one of the disclosed antibodies to a mammal in need thereof is disclosed. Also disclosed is a method for establishing a steady-state level of mature recombinant human GDF15 (rhGDF15) in plasma or serum in a mammal comprising administering a rhGDF15-immunoglobulin Fc (Fc-rhGDF15) fusion protein to the mammal. The Fc-rhGDF15 can be a mouse Fc mature recombinant human GDF15 (mFc-rhGDF15). In some embodiments, the mammal is a rodent, e.g., a mouse. In another aspect, a method of treating obesity in a mammal, for example, a human, comprising administering a therapeutically effective amount of Fc-rhGDF15, e.g., a human Fc mature recombinant human GDF 15 (hFc-rhGDF15), to the mammal in need thereof, is disclosed. Pharmaceutical compositions comprising an Fc-rhGDF15 fusion protein and a pharmaceutically acceptable carrier are also disclosed. These and other aspects and advantages of the invention will become apparent upon consideration of the following figures, detailed description, and claims. As used herein, “including” means without limitation, and examples cited are non-limiting. As used herein, “antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11” means antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11, or humanized variants thereof. DESCRIPTION OF THE DRAWINGS The invention can be more completely understood with reference to the following drawings. FIG. 1 (prior art) is a schematic representation of a typical naturally-occurring antibody. FIG. 2 is a graph representing results from an experiment to measure hGDF15 serum levels in naïve mice or mice bearing human xenograft tumors (Chago, RPMI7951, PC3, TOV21G, HT-1080, K-562, LS1034), as determined by ELISA. FIG. 3 is a plot representing results from an experiment to determine the plasma pharmacokinetics (PK) of cleaved rhGDF15 administered by subcutaneous injection (1 μg/g) in naïve ICR-SCID mice, as determined by ELISA. FIG. 4 is a graph summarizing results from an experiment to measure cachectic activity of cleaved rhGDF15 protein (▪) and negative control (PBS (●)) to induce body weight loss in immune-incompetent mice, ICR-SCID. Arrows indicate subcutaneous doses of 1 μg/g of rhGDF15. FIGS. 5A and 5B are graphs summarizing results from an experiment to measure cachectic activity of mFc-rhGDF15 (a mouse Fc fused to the amino terminus of a mature recombinant human GDF15; ▪), rFc-rmGDF15 (a rabbit Fc fused to the amino terminus of a mature recombinant mouse GDF15; ▴), and negative control (PBS; ●) to induce body weight loss in immune-competent Balb/C mice ( FIG. 5A ) and immune-incompetent CB17-SCID mice ( FIG. 5B ). Arrows indicate subcutaneous doses of 1 μg/g of recombinant protein. FIGS. 6A-6E are graphs summarizing results from an experiment to demonstrate cachectic activity of mFc-rhGDF15 (▪) and negative control (PBS; ●) to induce body weight loss in immune-incompetent ICR-SCID mice ( FIG. 6A ; arrows indicate subcutaneous doses of 1 μg/g of mFc-rhGDF15); to induce loss of adipose tissue or gonadal fat mass ( FIG. 6B ); to induce loss of muscle mass of gastrocnemius muscle ( FIG. 6C ; Gastroc Mass); and to increase mRNA expression of muscle degradation molecular markers (mMuRF1 ( FIG. 6D ) and mAtrogin ( FIG. 6E )). FIG. 7 is a graph summarizing results from an experiment to measure cachectic activity of mFc-rhGDF15 (▪) and negative control (PBS; ●) to induce body weight loss in immune-incompetent Balb/C nude mice. Arrows indicate subcutaneous doses of 1.33 μg/g of mFc-rhGDF15. FIG. 8 is a graph summarizing results from an experiment to measure serum levels of mFc-rhGDF15 in mice dosed with the recombinant protein. The presence of mFc-rhGDF15 was determined by Western Blot. Two positive bands corresponding to mFc-rhGDF15 and rhGDF15 (according to the appropriate molecular size) were quantified by Licor. The percentage of released-rhGDF15 versus mFc-rhGDF15 was calculated. FIG. 9A is a graph summarizing results from an experiment to measure cachectic activity of mFc-rhGDF15 (0.1 μg/g (▪), 0.01 μg/g (A)) and negative control (mIgG 0.1 μg/g (●)) to induce body weight loss in immune-incompetent ICR-SCID mice. Arrows indicate the intraperitoneal dose of the recombinant protein. FIG. 9B is a graph representing the total level of rhGDF15 in the plasma of mice dosed with mFc-rhGDF15 (0.1 μg/g (□), 0.01 μg/g (▪)) five days post dose, as determined by ELISA. FIG. 10 is a sequence alignment showing the amino acid sequence of the complete immunoglobulin heavy chain variable region of antibodies 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, and 17B11. The amino acid sequences for each antibody are aligned against one another, and CDR 1 , CDR 2 , and CDR 3 , are identified in boxes. The unboxed sequences represent framework (FR) sequences. Alignment positioning (gaps) is based on Kabat numbering, rather than an alignment algorithm such as Clustal. Numbering above the sequences represents Kabat numbering. FIG. 11 is a sequence alignment showing the CDR 1 , CDR 2 , and CDR 3 sequences for each of the immunoglobulin heavy chain variable region sequences in FIG. 10 . FIG. 12 is a sequence alignment showing the amino acid sequence of the complete immunoglobulin light chain variable region of antibodies 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, and 17B11. The amino acid sequences for each antibody are aligned against one another, and CDR 1 , CDR 2 , and CDR 3 , are identified in boxes. The unboxed sequences represent framework (FR) sequences. Alignment positioning (gaps) is based on Kabat numbering, rather than an alignment algorithm such as Clustal. Numbering above the sequences represents Kabat numbering. FIG. 13 is a sequence alignment showing the CDR 1 , CDR 2 , and CDR 3 sequences for each of the immunoglobulin light chain variable region sequences in FIG. 12 . FIG. 14 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 01G06 (▪), 03G05 (▴), 04F08 (▾), 06C11 (⋄), 14F11 (¤), and 17B11 ( ), and a murine IgG control (▪; mIgG) dosed at 10 mg/kg in an mFc-rhGDF15 cachectic model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody. FIG. 15 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 01G06 (▴), 03G05 (⋄), 04F08 (∇), 06C11 ( ), 08G01 (▪), 14F11 (♦), and 17B11 (*), and a murine IgG control (▪; mIgG), dosed at 10 mg/kg in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrows indicate intra-peritoneal injection of antibody every three days. FIGS. 16A-16E are graphs summarizing results from an experiment to demonstrate anti-cachectic activity of anti-GDF15 antibody 01G06 (▪), dosed at 10 mg/kg, in immune-incompetent mice (ICR-SCID) bearing an HT-1080 fibrosarcoma tumor xenograft model. Treatment with antibody 01G06 reversed body weight loss ( FIG. 16A ); induced a significant increase in food consumption for up to three days post dose ( FIG. 16B ); induced a gain of gonadal fat mass ( FIG. 16C ); induced a gain of muscle mass of gastrocnemius muscle ( FIG. 16D ); and decreased mRNA expression of muscle degradation molecular markers (mMuRF1 and mAtrogin ( FIG. 16E )) compared to negative control (murine IgG (●)). In FIG. 16A , the arrow indicates intra-peritoneal injection of antibody. FIGS. 17A-17B are graphs summarizing results from an experiment to demonstrate anti-cachectic activity of anti-GDF15 antibody 01G06 (▪), dosed at 2 mg/kg, in immune-incompetent mice (ICR-SCID) bearing an HT-1080 fibrosarcoma tumor xenograft model. Treatment with antibody 01G06 reversed body weight loss compared to murine IgG (●) ( FIG. 17A ); and induced a gain of organ mass (liver, heart, spleen, kidney) and induced a gain of tissue mass (gonadal and gastrocnemius) ( FIG. 17B ) compared to negative control (murine IgG) and baseline (day 1). The arrows in FIG. 17A indicate intra-peritoneal injection of antibody. FIG. 18 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 01G06 (▪), 03G05 (▴), 04F08 (X), 06C11 (♦), 08G01 (∘), 14F11 (□), and 17B11 (Δ), and a murine IgG control (●) dosed at 10 mg/kg in a K-562 leukemia tumor xenograft model in immune-incompetent (CB17SCRFMF) mice. The arrows indicate intra-peritoneal injection of antibody. FIG. 19 is a sequence alignment showing the amino acid sequence of the complete immunoglobulin heavy chain variable region of chimeric 01G06 variable region denoted as Ch01G06 Chimeric; humanized 01G06 heavy chain variable regions denoted as Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S I69L, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, and Hu01G06 IGHV1-69 F2; chimeric 06C11 denoted as Ch06C11 Chimeric; humanized 06C11 heavy chain variable regions denoted as HE LM 06C11 IGHV2-70, and Hu06C11 IGHV2-5; chimeric 14F11 denoted as Ch14F11 Chimeric; and humanized 14F11 heavy chain variable regions denoted as Sh14F11 IGHV2-5 and Sh14F11 IGHV2-70. The amino acid sequences for each antibody are aligned against one another, and CDR 1 , CDR 2 , and CDR 3 , are identified in boxes. The unboxed sequences represent framework (FR) sequences. Alignment positioning (gaps) is based on Kabat numbering, rather than an alignment algorithm such as Clustal. Numbering above the sequences represents Kabat numbering. FIG. 20 is a sequence alignment showing the CDR 1 , CDR 2 , and CDR 3 sequences for each of the immunoglobulin heavy chain variable region sequences in FIG. 19 . FIG. 21 is a sequence alignment showing the amino acid sequence of the complete immunoglobulin light chain variable region of chimeric 01G06 denoted as Ch01G06 Chimeric; humanized 01G06 light chain variable regions denoted as Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, and Hu01G06 IGKV1-39 F2; chimeric 06C11 denoted as Ch06C11 Chimeric; humanized 06C11 light chain variable region denoted as Sh06C11 IGKV1-16; chimeric 14F11 denoted as Ch14F11 Chimeric; and humanized 14F11 light chain variable region denoted as Hu14F11 IGKV1-16. The amino acid sequences for each antibody are aligned against one another, and CDR 1 , CDR 2 , and CDR 3 , are identified in boxes. The unboxed sequences represent framework (FR) sequences. Alignment positioning (gaps) is based on Kabat numbering, rather than an alignment algorithm such as Clustal. Numbering above the sequences represents Kabat numbering. FIG. 22 is a sequence alignment showing the CDR 1 , CDR 2 , and CDR 3 sequences for each of the immunoglobulin light chain variable region sequences in FIG. 21 . FIG. 23 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 01G06 (▪), Hu01G06-46 (▴), and Hu01G06-52 (*), and a murine IgG control (▪) dosed at 2 mg/kg in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody. FIG. 24 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 06C11 (⋄), Hu06C11-27 (□), and Hu06C11-30 (▴), and a murine IgG control (●) dosed at 2 mg/kg in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody. FIG. 25 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies 14F11 (▴), Hu14F11-39 (□), and Hu14F11-47 (♦), and a murine IgG control (●) dosed at 2 mg/kg in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody. FIG. 26 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies Hu01G06-122 (▾), Hu01G06-127 (□), Hu01G06-135 (⋄), Hu01G06-138 (▪), and Hu01G06-146 (*), and a human IgG control (●) dosed at 2 mg/kg in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody. FIG. 27 is a graph summarizing results from an experiment to measure cachectic inhibitory activity of anti-GDF15 antibodies Hu01G06-122 (▾), Hu01G06-127 (□), Hu01G06-135 (⋄), Hu01G06-138 (▪), and Hu01G06-146 (*), and a human IgG control (●) dosed at 2 mg/kg in an mFc-rhGDF15 cachectic model in ICR-SCID mice. The arrow indicates intra-peritoneal injection of antibody. FIG. 28 is a graph summarizing results from an experiment to measure cachectic dose response inhibitory activity of anti-GDF15 antibodies Hu01G06-127 dosed at 20 mg/kg (□), 2 mg/kg (Δ), and 0.2 mg/kg (∇); Hu01G06-135 at 20 mg/kg (▪), 2 mg/kg (▴), and 0.2 mg/kg (▾), and a human IgG control at 20 mg/kg (*) in an HT-1080 fibrosarcoma tumor xenograft model in ICR-SCID mice. The arrow indicates intravenous injection of antibody. FIGS. 29A-29C are graphs summarizing results from an experiment to demonstrate anti-cachectic activity of anti-GDF15 antibodies Hu01G06-127 (▪), dosed at 10 mg/kg, in immune-incompetent mice (ICR-SCID) bearing an HT-1080 fibrosarcoma tumor xenograft model. Treatment with antibody Hu01G06-127 reversed body weight loss ( FIG. 29A ); induced a gain of gonadal fat mass ( FIG. 29B ); and induced a gain of muscle mass of gastrocnemius muscle ( FIG. 29 C) compared to negative control (hIgG (●); FIG. 29A ) similar to levels found in non tumor bearing mice (SHAM (▴); FIG. 29A ). The arrows in FIG. 29A indicate intra-peritoneal injection of antibody. DETAILED DESCRIPTION The anti-GDF15 antibodies disclosed herein are based on the antigen binding sites of certain monoclonal antibodies that have been selected on the basis of binding and neutralization of human GDF15 (hGDF15). The antibodies contain immunoglobulin variable region CDR sequences that define a binding site for hGDF15. By virtue of the neutralizing activity of these antibodies, they are useful for treating cachexia and/or sarcopenia. For use as therapeutic agents, the antibodies can be engineered to minimize or eliminate an immune response when administered to a human patient. Various features and aspects of the invention are discussed in more detail below. As used herein, “cachexia” means a metabolic syndrome associated with underlying disease and characterized by involuntary loss of muscle mass. Cachexia is often accompanied by involuntary weight loss, loss of fat mass, anorexia, inflammation, insulin resistance, fatigue, weakness, significant loss of appetite, and/or increased muscle protein breakdown. Cachexia is distinct from starvation, age-related loss of muscle mass, malabsorption, and hyperthyroidism. Underlying diseases associated with cachexia include cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis. As used herein, “sarcopenia” is understood to be a condition characterized primarily by loss of skeletal muscle mass and muscle strength. Sarcopenia is frequently associated with aging. See, Ruegg and Glass (2011) A NNUAL R EV . P HARMACOL . T OXICOL . 51:373-395. In one approach, sarcopenia can be identified in a subject if a value of the appendicular skeletal muscle mass of a subject divided by the height of the subject in meters is more than two standard deviations below the young normal mean. (Thomas (2007) supra; see also Baumgartner et al. (1999) M ECH . A GEING D EV . 147:755-763). As used herein, unless otherwise indicated, “antibody” means an intact antibody (e.g., an intact monoclonal antibody) or antigen-binding fragment of an antibody, including an intact antibody or antigen-binding fragment that has been modified or engineered, or that is a human antibody. Examples of antibodies that have been modified or engineered are chimeric antibodies, humanized antibodies, and multispecific antibodies (e.g., bispecific antibodies). Examples of antigen-binding fragments include Fab, Fab′, F(ab′) 2 , Fv, single chain antibodies (e.g., scFv), minibodies and diabodies. I. Antibodies that Bind GDF15 The antibodies disclosed herein comprise: (a) an immunoglobulin heavy chain variable region comprising the structure CDR H1 -CDR H2 -CDR H3 and (b) an immunoglobulin light chain variable region comprising the structure CDR L1 -CDR L2 -CDR L3 , wherein the heavy chain variable region and the light chain variable region together define a single binding site for binding hGDF15 protein. In some embodiments, the antibody comprises: (a) an immunoglobulin heavy chain variable region comprising the structure CDR H1 -CDR H2 -CDR H3 and (b) an immunoglobulin light chain variable region, wherein the heavy chain variable region and the light chain variable region together define a single binding site for binding hGDF15. A CDR H1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:1 (01G06, 08G01, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S I69L, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), SEQ ID NO:2 (03G05), SEQ ID NO:3 (04F08), SEQ ID NO:4 (06C11, Ch06C11 Chimeric, HE LM 06C11 IGHV2-70, Hu06C11 IGHV2-5), SEQ ID NO:5 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and SEQ ID NO:6 (17B11); a CDR H2 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:7 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:8 (03G05), SEQ ID NO:9 (04F08, 06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), SEQ ID NO:10 (08G01), SEQ ID NO:11 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), SEQ ID NO:12 (17B11), SEQ ID NO:13 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:236 (Hu01G06 IGHV1-18 F1), SEQ ID NO:237 (Hu01G06 IGHV1-18 F2), SEQ ID NO:238 (Hu01G06 IGHV1-69 F1), SEQ ID NO:239 (Hu01G06 IGHV1-69 F2), and SEQ ID NO:14 (HE LM 06C11 IGHV2-70); and a CDR H3 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:15 (01G06, 08G01, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S I69L, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), SEQ ID NO:16 (03G05), SEQ ID NO:17 (04F08), SEQ ID NO:18 (06C11, Ch06C11 Chimeric, HE LM 06C11 IGHV2-70, Hu06C11 IGHV2-5), SEQ ID NO:19 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and SEQ ID NO:20 (17B11). Throughout this specification, a particular SEQ ID NO. is followed in parentheses by the antibody that was the origin of that sequence. For example, “SEQ ID NO:2 (03G05)” means that SEQ ID NO:2 comes from antibody 03G05. In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-69 T30S I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR H2 comprising the amino acid sequence of SEQ ID NO:7 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-69 T30S I69L), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-69 T30S I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:2 (03G05), a CDR H2 comprising the amino acid sequence of SEQ ID NO:8 (03G05), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:16 (03G05). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:3 (04F08), a CDR H2 comprising the amino acid sequence of SEQ ID NO:9 (04F08), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:17 (04F08). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:4 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), a CDR H2 comprising the amino acid sequence of SEQ ID NO:9 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:18 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (08G01), a CDR H2 comprising the amino acid sequence of SEQ ID NO:10 (08G01), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (08G01). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:5 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), a CDR H2 comprising the amino acid sequence of SEQ ID NO:11 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:19 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:6 (17B11), a CDR H2 comprising the amino acid sequence of SEQ ID NO:12 (17B11), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:20 (17B11). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR H2 comprising the amino acid sequence of SEQ ID NO:13 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR H2 comprising the amino acid sequence of SEQ ID NO:236 (Hu01G06 IGHV1-18 F1), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR H2 comprising the amino acid sequence of SEQ ID NO:237 (Hu01G06 IGHV1-18 F2), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR H2 comprising the amino acid sequence of SEQ ID NO:238 (Hu01G06 IGHV1-69 F1), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), a CDR H2 comprising the amino acid sequence of SEQ ID NO:239 (Hu01G06 IGHV1-69 F2), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising the amino acid sequence of SEQ ID NO:4 (HE LM 06C11 IGHV2-70), a CDR H2 comprising the amino acid sequence of SEQ ID NO:14 (HE LM 06C11 IGHV2-70), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:18 (HE LM 06C11 IGHV2-70). Preferably, the CDR H1 , CDR H2 , and CDR H3 sequences are interposed between fully human or humanized immunoglobulin FR sequences. In some embodiments, the antibody comprises (a) an immunoglobulin light chain variable region comprising the structure CDR L1 -CDR L2 -CDR L3 , and (b) an immunoglobulin heavy chain variable region, wherein the immunoglobulin light chain variable region and the immunoglobulin heavy chain variable region together define a single binding site for binding hGDF15. A CDR L1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), SEQ ID NO:22 (03G05), SEQ ID NO:23 (04F08, 06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16, 14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), SEQ ID NO:24 (08G01), and SEQ ID NO:25 (17B11); a CDR L2 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), SEQ ID NO:27 (03G05), SEQ ID NO:28 (04F08, 06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), SEQ ID NO:29 (08G01), SEQ ID NO:30 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and SEQ ID NO:31 (17B11); and a CDR L3 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, 08G01, Hu01G06 IGKV1-39 F1), SEQ ID NO:244 (Hu01G06 IGKV1-39 F2), SEQ ID NO:33 (03G05), SEQ ID NO:34 (04F08), SEQ ID NO:35 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), SEQ ID NO:36 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and SEQ ID NO:37 (17B11). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:22 (03G05), a CDR L2 comprising the amino acid sequence of SEQ ID NO:27 (03G05), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:33 (03G05). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (04F08), a CDR L2 comprising the amino acid sequence of SEQ ID NO:28 (04F08), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:34 (04F08). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), a CDR L2 comprising the amino acid sequence of SEQ ID NO:28 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:35 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:24 (08G01), a CDR L2 comprising the amino acid sequence of SEQ ID NO:29 (08G01), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (08G01). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:23 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), a CDR L2 comprising the amino acid sequence of SEQ ID NO:30 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:36 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:25 (17B11), a CDR L2 comprising the amino acid sequence of SEQ ID NO:31 (17B11), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:37 (17B11). Preferably, the CDR L1 , CDR L2 , and CDR L3 sequences are interposed between fully human or humanized immunoglobulin FR sequences. In some embodiments, the antibody comprises: (a) an immunoglobulin heavy chain variable region comprising the structure CDR H1 -CDR H2 -CDR H3 and (b) an immunoglobulin light chain variable region comprising the structure CDR L1 -CDR L2 -CDR L3 , wherein the heavy chain variable region and the light chain variable region together define a single binding site for binding hGDF15. The CDR H1 is an amino acid sequence selected from the group consisting of SEQ ID NO:1 (01G06, 08G01, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S I69L, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), SEQ ID NO:2 (03G05), SEQ ID NO:3 (04F08), SEQ ID NO:4 (06C11, Ch06C11 Chimeric, HE LM 06C11 IGHV2-70, Hu06C11 IGHV2-5), SEQ ID NO:5 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and SEQ ID NO:6 (17B11); the CDR H2 is an amino acid sequence selected from the group consisting of SEQ ID NO:7 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:8 (03G05), SEQ ID NO:9 (04F08, 06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), SEQ ID NO:10 (08G01), SEQ ID NO:11 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), SEQ ID NO:12 (17B11), SEQ ID NO:13 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:236 (Hu01G06 IGHV1-18 F1), SEQ ID NO:237 (Hu01G06 IGHV1-18 F2), SEQ ID NO:238 (Hu01G06 IGHV1-69 F1), SEQ ID NO:239 (Hu01G06 IGHV1-69 F2), and SEQ ID NO:14 (HE LM 06C11 IGHV2-70); and the CDR H3 is an amino acid sequence selected from the group consisting of SEQ ID NO:15 (01G06, 08G01, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S I69L, Sh01G06 IGHV1-69 T30S K64Q I69L, Hu01G06 IGHV1-18 F1, Hu01G06 IGHV1-18 F2, Hu01G06 IGHV1-69 F1, Hu01G06 IGHV1-69 F2), SEQ ID NO:16 (03G05), SEQ ID NO:17 (04F08), SEQ ID NO:18 (06C11, Ch06C11 Chimeric, HE LM 06C11 IGHV2-70, Hu06C11 IGHV2-5), SEQ ID NO:19 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and SEQ ID NO:20 (17B11). The CDR L1 is an amino acid sequence selected from the group consisting of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), SEQ ID NO:22 (03G05), SEQ ID NO:23 (04F08, 06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16, 14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), SEQ ID NO:24 (08G01), and SEQ ID NO:25 (17B11); the CDR L2 is an amino acid sequence selected from the group consisting of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, Hu01G06 IGKV1-39 F1, Hu01G06 IGKV1-39 F2), SEQ ID NO:27 (03G05), SEQ ID NO:28 (04F08, 06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), SEQ ID NO:29 (08G01), SEQ ID NO:30 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and SEQ ID NO:31 (17B11); and the CDR L3 is an amino acid sequence selected from the group consisting of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I, 08G01, Hu01G06 IGKV1-39 F1), SEQ ID NO:244 (Hu01G06 IGKV1-39 F2), SEQ ID NO:33 (03G05), SEQ ID NO:34 (04F08), SEQ ID NO:35 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), SEQ ID NO:36 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and SEQ ID NO:37 (17B11). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:38 (Hu01G06 IGHV1-18 F1), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:236 and SEQ ID NO:240 (Hu01G06 IGHV1-18 F1), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-18 F1); and an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:38 (Hu01G06 IGHV1-18 F2), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:237 and SEQ ID NO:241 (Hu01G06 IGHV1-18 F2), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-18 F2); and an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F1), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:238 and SEQ ID NO:241 (Hu01G06 IGHV1-69 F1), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F1); and an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F2), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:239 and SEQ ID NO:240 (Hu01G06 IGHV1-69 F2), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F2); and an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F2), a CDR H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:239 and SEQ ID NO:240 (Hu01G06 IGHV1-69 F2), and a CDR H3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F2); and an immunoglobulin light chain variable region comprising a CDR L1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F2), a CDR L2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F2), and a CDR L3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2). The antibodies disclosed herein comprise an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region. In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region selected from the group consisting of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), SEQ ID NO:42 (03G05), SEQ ID NO:44 (04F08), SEQ ID NO:46 (06C11, Ch06C11 Chimeric), SEQ ID NO:48 (08G01), SEQ ID NO:50 (14F11, Ch14F11 Chimeric), SEQ ID NO:52 (17B11), SEQ ID NO:54 (Hu01G06 IGHV1-18), SEQ ID NO:56 (Hu01G06 IGHV1-69), SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), SEQ ID NO:68 (HE LM 06C11 IGHV2-70), SEQ ID NO:70 (Hu06C11 IGHV2-5), SEQ ID NO:72 (Sh14F11 IGHV2-5), and SEQ ID NO:74 (Sh14F11 IGHV2-70); and an immunoglobulin light chain variable region. In other embodiments, the antibody comprises an immunoglobulin light chain variable region selected from the group consisting of SEQ ID NO:76 (01G06, Ch01G06 Chimeric), SEQ ID NO:78 (03G05), SEQ ID NO:80 (04F08), SEQ ID NO:82 (06C11, Ch06C11 Chimeric), SEQ ID NO:84 (08G01), SEQ ID NO:86 (14F11, Ch14F11 Chimeric), SEQ ID NO:88 (17B11), SEQ ID NO:90 (Hu01G06 IGKV1-39), SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I or Hu01G06 IGKV1-39 F1), SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I), SEQ ID NO:96 (Sh06C11 IGKV1-16), SEQ ID NO:254 (Hu01G06 IGKV1-39 F2), and SEQ ID NO:98 (Hu14F11 IGKV1-16), and an immunoglobulin heavy chain variable region. In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region selected from the group consisting of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), SEQ ID NO:42 (03G05), SEQ ID NO:44 (04F08), SEQ ID NO:46 (06C11, Ch06C11 Chimeric), SEQ ID NO:48 (08G01), SEQ ID NO:50 (14F11, Ch14F11 Chimeric), SEQ ID NO:52 (17B11), SEQ ID NO:54 (Hu01G06 IGHV1-18), SEQ ID NO:56 (Hu01G06 IGHV1-69), SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), SEQ ID NO:68 (HE LM 06C11 IGHV2-70), SEQ ID NO:70 (Hu06C11 IGHV2-5), SEQ ID NO:72 (Sh14F11 IGHV2-5), and SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region selected from the group consisting of SEQ ID NO:76 (01G06, Ch01G06 Chimeric), SEQ ID NO:78 (03G05), SEQ ID NO:80 (04F08), SEQ ID NO:82 (06C11, Ch06C11 Chimeric), SEQ ID NO:84 (08G01), SEQ ID NO:86 (14F11, Ch14F11 Chimeric), SEQ ID NO:88 (17B11), SEQ ID NO:90 (Hu01G06 IGKV1-39), SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I or Hu01G06 IGKV1-39 F1), SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I), SEQ ID NO:96 (Sh06C11 IGKV1-16), SEQ ID NO:254 (Hu01G06 IGKV1-39 F2), and SEQ ID NO:98 (Hu14F11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (01G06, Ch01G06 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:42 (03G05), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:78 (03G05). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:44 (04F08), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:80 (04F08). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (06C11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (06C11). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:48 (08G01), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:84 (08G01). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (14F11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (14F11). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:52 (17B11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:88 (17B11). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39). In some embodiments, the antibody comprises an immuoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:68 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:70 (Hu06C11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (Ch06C11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:68 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:70 (Hu06C11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:72 (Sh14F11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (Ch14F11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:72 (Sh14F11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (Ch06C11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:80 (04F08). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (Ch14F11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:80 (04F08). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:44 (04F08), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (Ch14F11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:44 (04F08), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (Ch06C11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:48 (08G01), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:84 (08G01). In certain embodiments, the antibodies disclosed herein comprise an immunoglobulin heavy chain and an immunoglobulin light chain. In some embodiments, the antibody comprises an immunoglobulin heavy chain selected from the group consisting of SEQ ID NO:100 (01G06), SEQ ID NO:104 (03G05), SEQ ID NO:108 (04F08), SEQ ID NO:112 (06C11), SEQ ID NO:116 (08G01), SEQ ID NO:120 (14F11), SEQ ID NO:124 (17B11), SEQ ID NO:176 (Ch01G06 Chimeric), SEQ ID NO:178 (Hu01G06 IGHV1-18), SEQ ID NO:180 (Hu01G06 IGHV1-69), SEQ ID NO:182 (Sh01G06 IGHV1-18 M69L), SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), SEQ ID NO:186 (Sh01G06 IGHV1-18 M69L K64Q), SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:190 (Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:256 (Hu01G06 IGHV1-18 F1), SEQ ID NO:258 (Hu01G06 IGHV1-18 F2), SEQ ID NO:260 (Hu01G06 IGHV1-69 F1), SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), SEQ ID NO:192 (Ch06C11 Chimeric), SEQ ID NO:194 (HE LM 06C11 IGHV2-70), SEQ ID NO:196 (Hu06C11 IGHV2-5), SEQ ID NO:198 (Ch14F11 Chimeric), SEQ ID NO:200 (Sh14F11 IGHV2-5), and SEQ ID NO:202 (Sh14F11 IGHV2-70); and an immunoglobulin light chain. In other embodiments, the antibody comprises an immunoglobulin light chain selected from the group consisting of SEQ ID NO:102 (01G06), SEQ ID NO:106 (03G05), SEQ ID NO:110 (04F08), SEQ ID NO:114 (06C11), SEQ ID NO:118 (08G01), SEQ ID NO:122 (14F11), SEQ ID NO:126 (17B11), SEQ ID NO:204 (Ch01G06 Chimeric), SEQ ID NO:206 (Hu01G06 IGKV1-39), SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I or Hu01G06 IGKV1-39 F1), SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I), SEQ ID NO:264 (Hu01G06 IGKV1-39 F2), SEQ ID NO:212 (Ch06C11 Chimeric), SEQ ID NO:214 (Sh06C11 IGKV1-16), SEQ ID NO:216 (Ch14F11 Chimeric), and SEQ ID NO:218 (Hu14F11 IGKV1-16), and an immunoglobulin heavy chain. In some embodiments, the antibody comprises (i) an immunoglobulin heavy chain selected from the group consisting of SEQ ID NO:100 (01G06), SEQ ID NO:104 (03G05), SEQ ID NO:108 (04F08), SEQ ID NO:112 (06C11), SEQ ID NO:116 (08G01), SEQ ID NO:120 (14F11), SEQ ID NO:124 (17B11), SEQ ID NO:176 (Ch01G06 Chimeric), SEQ ID NO:178 (Hu01G06 IGHV1-18), SEQ ID NO:180 (Hu01G06 IGHV1-69), SEQ ID NO:182 (Sh01G06 IGHV1-18 M69L), SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), SEQ ID NO:186 (Sh01G06 IGHV1-18 M69L K64Q), SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:190 (Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:256 (Hu01G06 IGHV1-18 F1), SEQ ID NO:258 (Hu01G06 IGHV1-18 F2), SEQ ID NO:260 (Hu01G06 IGHV1-69 F1), SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), SEQ ID NO:192 (Ch06C11 Chimeric), SEQ ID NO:194 (HE LM 06C11 IGHV2-70), SEQ ID NO:196 (Hu06C11 IGHV2-5), SEQ ID NO:198 (Ch14F11 Chimeric), SEQ ID NO:200 (Sh14F11 IGHV2-5), and SEQ ID NO:202 (Sh14F11 IGHV2-70), and (ii) an immunoglobulin light chain selected from the group consisting of SEQ ID NO:102 (01G06), SEQ ID NO:106 (03G05), SEQ ID NO:110 (04F08), SEQ ID NO:114 (06C11), SEQ ID NO:118 (08G01), SEQ ID NO:122 (14F11), SEQ ID NO:126 (17B11), SEQ ID NO:204 (Ch01G06 Chimeric), SEQ ID NO:206 (Hu01G06 IGKV1-39), SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I or Hu01G06 IGKV1-39 F1), SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I), SEQ ID NO:264 (Hu01G06 IGKV1-39 F2), SEQ ID NO:212 (Ch06C11 Chimeric), SEQ ID NO:214 (Sh06C11 IGKV1-16), SEQ ID NO:216 (Ch14F11 Chimeric), and SEQ ID NO:218 (Hu14F11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:176 (Ch01G06 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:204 (Ch01G06 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:192 (Ch06C11 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:212 (Ch06C11 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:198 (Ch14F11 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:216 (Ch14F11 Chimeric). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:178 (Hu01G06 IGHV1-18), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:180 (Hu01G06 IGHV1-69), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:256 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:258 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:264 (Hu01G06 IGKV1-39 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:260 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:264 (Hu01G06 IGKV1-39 F2). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:194 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:214 (Sh06C11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:196 (Hu06C11 IGHV2-5), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:214 (Sh06C11 IGKV1-16). In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:200 (Sh14F11 IGHV2-5), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:218 (Hu14F11 IGKV1-16) In some embodiments, the antibody comprises an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:202 (Sh14F11 IGHV2-70), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:218 (Hu14F11 IGKV1-16). In certain embodiments, an isolated antibody that binds hGDF15 comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the entire variable region or the FR sequence of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), SEQ ID NO:42 (03G05), SEQ ID NO:44 (04F08), SEQ ID NO:46 (06C11, Ch06C11 Chimeric), SEQ ID NO:48 (08G01), SEQ ID NO:50 (14F11, Ch14F11 Chimeric), SEQ ID NO:52 (17B11), SEQ ID NO:54 (Hu01G06 IGHV1-18), SEQ ID NO:56 (Hu01G06 IGHV1-69), SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), SEQ ID NO:68 (HE LM 06C11 IGHV2-70), SEQ ID NO:70 (Hu06C11 IGHV2-5), SEQ ID NO:72 (Sh14F11 IGHV2-5), and SEQ ID NO:74 (Sh14F11 IGHV2-70). In certain embodiments, an isolated antibody that binds hGDF15 comprises an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the entire variable region or the FR sequence of SEQ ID NO:76 (01G06, Ch01G06 Chimeric), SEQ ID NO:78 (03G05), SEQ ID NO:80 (04F08), SEQ ID NO:82 (06C11, Ch06C11 Chimeric), SEQ ID NO:84 (08G01), SEQ ID NO:86 (14F11, Ch14F11 Chimeric), SEQ ID NO:88 (17B11), SEQ ID NO:90 (Hu01G06 IGKV1-39), SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I or Hu01G06 IGKV1-39 F1), SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I), SEQ ID NO:254 (Hu01G06 IGKV1-39 F2), SEQ ID NO:96 (Sh06C11 IGKV1-16), and SEQ ID NO:98 (Hu14F11 IGKV1-16). Sequence identity may be determined in various ways that are within the skill of a person skilled in the art, e.g., using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. BLAST (Basic Local Alignment Search Tool) analysis using the algorithm employed by the programs blastp, blastn, blastx, tblastn and tblastx (Karlin et al., (1990) P ROC . N ATL . A CAD . S CI . USA 87:2264-2268; Altschul, (1993) J. M OL . E VOL . 36:290-300; Altschul et al., (1997) N UCLEIC A CIDS R ES . 25:3389-3402, incorporated by reference herein) are tailored for sequence similarity searching. For a discussion of basic issues in searching sequence databases see Altschul et al., (1994) N ATURE G ENETICS 6:119-129, which is fully incorporated by reference herein. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. The search parameters for histogram, descriptions, alignments, expect (i.e., the statistical significance threshold for reporting matches against database sequences), cutoff, matrix and filter are at the default settings. The default scoring matrix used by blastp, blastx, tblastn, and tblastx is the BLOSUM62 matrix (Henikoff et al., (1992) P ROC . N ATL . A CAD . S CI . USA 89:10915-10919, fully incorporated by reference herein). Four blastn parameters may be adjusted as follows: Q=10 (gap creation penalty); R=10 (gap extension penalty); wink=1 (generates word hits at every wink.sup.th position along the query); and gapw=16 (sets the window width within which gapped alignments are generated). The equivalent Blastp parameter settings may be Q=9; R=2; wink=1; and gapw=32. Searches may also be conducted using the NCBI (National Center for Biotechnology Information) BLAST Advanced Option parameter (e.g.: -G, Cost to open gap [Integer]: default=5 for nucleotides/11 for proteins; -E, Cost to extend gap [Integer]: default=2 for nucleotides/1 for proteins; -q, Penalty for nucleotide mismatch [Integer]: default=−3; -r, reward for nucleotide match [Integer]: default=1; -e, expect value [Real]: default=10; -W, wordsize [Integer]: default=11 for nucleotides/28 for megablast/3 for proteins; -y, Dropoff (X) for blast extensions in bits: default=20 for blastn/7 for others; -X, X dropoff value for gapped alignment (in bits): default=15 for all programs, not applicable to blastn; and —Z, final X dropoff value for gapped alignment (in bits): 50 for blastn, 25 for others). ClustalW for pairwise protein alignments may also be used (default parameters may include, e.g., Blosum62 matrix and Gap Opening Penalty=10 and Gap Extension Penalty=0.1). A Bestfit comparison between sequences, available in the GCG package version 10.0, uses DNA parameters GAP=50 (gap creation penalty) and LEN=3 (gap extension penalty). The equivalent settings in Bestfit protein comparisons are GAP=8 and LEN=2. In each of the foregoing embodiments, it is contemplated herein that immunoglobulin heavy chain variable region sequences and/or light chain variable region sequences that together bind human GDF15 may contain amino acid alterations (e.g., at least 1, 2, 3, 4, 5, or 10 amino acid substitutions, deletions, or additions) in the framework regions of the heavy and/or light chain variable regions. In some embodiments, the antibody binds hGDF15 with a K D of about 300 pM, 250 pM, 200 pM, 190 pM, 180 pM, 170 pM, 160 pM, 150 pM, 140 pM, 130 pM, 120 pM, 110 pM, 100 pM, 90 pM, 80 pM, 70 pM, 60 pM, 50 pM, 40 pM, 30 pM, 20 pM, or 10 pM, or lower. Unless otherwise specified, K D values are determined by surface plasmon resonance methods or biolayer interferometry under the conditions described in Examples 8, 14, and 15. In some embodiments, a monoclonal antibody binds to the same epitope on hGDF15 (e.g., mature hGDF15 or cleaved rhGDF15) bound by one or more of the antibodies disclosed herein (e.g., antibodies 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11). In some embodiments, a monoclonal antibody competes for binding to hGDF15 with one or more of the antibodies disclosed herein (e.g., antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11). Competition assays for determining whether an antibody binds to the same epitope as, or competes for binding with, an anti-GDF15 antibody disclosed herein are known in the art. Exemplary competition assays include immunoassays (e.g., ELISA assays, RIA assays), surface plasmon resonance analysis (e.g., using a BIAcore™ instrument), biolayer interferometry and flow cytometry. Typically, a competition assay involves the use of an antigen (e.g., a hGDF15 protein or fragment thereof) bound to a solid surface or expressed on a cell surface, a test anti-GDF15-binding antibody and a reference antibody (e.g., antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11). The reference antibody is labeled and the test antibody is unlabeled. Competitive inhibition is measured by determining the amount of labeled reference antibody bound to the solid surface or cells in the presence of the test antibody. Usually the test antibody is present in excess (e.g., 1×, 5×, 10×, 20× or 100×). Antibodies identified by competition assay (i.e., competing antibodies) include antibodies binding to the same epitope, or similar (e.g., overlapping) epitopes, as the reference antibody, and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur. In an exemplary competition assay, a reference anti-GDF15 antibody (e.g., antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) is biotinylated using commercially available reagents. The biotinylated reference antibody is mixed with serial dilutions of the test antibody or unlabeled reference antibody (self-competition control) resulting in a mixture of various molar ratios (e.g., 1×, 5×, 10×, 20× or 100×) of test antibody (or unlabeled reference antibody) to labeled reference antibody. The antibody mixture is added to a hGDF15 polypeptide coated-ELISA plate. The plate is then washed, and horseradish peroxidase (HRP)-strepavidin is added to the plate as the detection reagent. The amount of labeled reference antibody bound to the target antigen is detected following addition of a chromogenic substrate (e.g., TMB (3,3′,5,5′-tetramethylbenzidine) or ABTS (2,2″-azino-di-(3-ethylbenzthiazoline-6-sulfonate)), which are known in the art. Optical density readings (OD units) are measured using a SpectraMax® M2 spectrometer (Molecular Devices). OD units corresponding to zero percent inhibition are determined from wells without any competing antibody. OD units corresponding to 100% inhibition, i.e., the assay background are determined from wells without any labeled reference antibody or test antibody. Percent inhibition of labeled reference antibody to GDF15 by the test antibody (or the unlabeled reference antibody) at each concentration is calculated as follows: % inhibition=(1−(OD units−100% inhibition)/(0% inhibition−100% inhibition))*100. Persons skilled in the art will appreciate that the competition assay can be performed using various detection systems known in the art. A competition assay may be conducted in both directions to ensure that the presence of the label does not interfere or otherwise inhibit binding. For example, in the first direction the reference antibody is labeled and the test antibody is unlabeled, and in the second direction, the test antibody is labeled and the reference antibody is unlabeled. A test antibody competes with the reference antibody for specific binding to the antigen if an excess of one antibody (e.g., 1×, 5×, 10×, 20× or 100×) inhibits binding of the other antibody, e.g., by at least 50%, 75%, 90%, 95% or 99%, as measured in a competitive binding assay. Two antibodies bind to the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other. Two antibodies bind to overlapping epitopes if only a subset of the amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other. II. Production of Antibodies Methods for producing antibodies, such as those disclosed herein, are known in the art. For example, DNA molecules encoding light chain variable regions and/or heavy chain variable regions can be chemically synthesized using the sequence information provided herein. Synthetic DNA molecules can be ligated to other appropriate nucleotide sequences, including, e.g., constant region coding sequences, and expression control sequences, to produce conventional gene expression constructs encoding the desired antibodies. Production of defined gene constructs is within routine skill in the art. Alternatively, the sequences provided herein can be cloned out of hybridomas by conventional hybridization techniques or polymerase chain reaction (PCR) techniques, using synthetic nucleic acid probes whose sequences are based on sequence information provided herein, or prior art sequence information regarding genes encoding the heavy and light chains of murine antibodies in hybridoma cells. Nucleic acids encoding desired antibodies can be incorporated (ligated) into expression vectors, which can be introduced into host cells through conventional transfection or transformation techniques. Exemplary host cells are E. coli cells, Chinese hamster ovary (CHO) cells, human embryonic kidney 293 (HEK 293) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), and myeloma cells that do not otherwise produce IgG protein. Transformed host cells can be grown under conditions that permit the host cells to express the genes that encode the immunoglobulin light and/or heavy chain variable regions. Specific expression and purification conditions will vary depending upon the expression system employed. For example, if a gene is to be expressed in E. coli , it is first cloned into an expression vector by positioning the engineered gene downstream from a suitable bacterial promoter, e.g., Trp or Tac, and a prokaryotic signal sequence. The expressed secreted protein accumulates in refractile or inclusion bodies, and can be harvested after disruption of the cells by French press or sonication. The refractile bodies then are solubilized, and the proteins refolded and cleaved by methods known in the art. If the engineered gene is to be expressed in eukayotic host cells, e.g., CHO cells, it is first inserted into an expression vector containing a suitable eukaryotic promoter, a secretion signal, a poly A sequence, and a stop codon. Optionally, the vector or gene construct may contain enhancers and introns. This expression vector optionally contains sequences encoding all or part of a constant region, enabling an entire, or a part of, a heavy or light chain to be expressed. The gene construct can be introduced into eukaryotic host cells using conventional techniques. The host cells express V L or V H fragments, V L -V H heterodimers, V H -V L or V L -V H single chain polypeptides, complete heavy or light immunoglobulin chains, or portions thereof, each of which may be attached to a moiety having another function (e.g., cytotoxicity). In some embodiments, a host cell is transfected with a single vector expressing a polypeptide expressing an entire, or part of, a heavy chain (e.g., a heavy chain variable region) or a light chain (e.g., a light chain variable region). In some embodiments, a host cell is transfected with a single vector encoding (a) a polypeptide comprising a heavy chain variable region and a polypeptide comprising a light chain variable region, or (b) an entire immunoglobulin heavy chain and an entire immunoglobulin light chain. In some embodiments, a host cell is co-transfected with more than one expression vector (e.g., one expression vector expressing a polypeptide comprising an entire, or part of, a heavy chain or heavy chain variable region, and another expression vector expressing a polypeptide comprising an entire, or part of, a light chain or light chain variable region). A polypeptide comprising an immunoglobulin heavy chain variable region or light chain variable region can be produced by growing (culturing) a host cell transfected with an expression vector encoding such a variable region, under conditions that permit expression of the polypeptide. Following expression, the polypeptide can be harvested and purified or isolated using techniques known in the art, e.g., affinity tags such as glutathione-S-transferase (GST) or histidine tags. A monoclonal antibody that binds hGDF15, or an antigen-binding fragment of the antibody, can be produced by growing (culturing) a host cell transfected with: (a) an expression vector that encodes a complete or partial immunoglobulin heavy chain, and a separate expression vector that encodes a complete or partial immunoglobulin light chain; or (b) a single expression vector that encodes both chains (e.g., complete or partial heavy and light chains), under conditions that permit expression of both chains. The intact antibody (or antigen-binding fragment) can be harvested and purified or isolated using techniques known in the art, e.g., Protein A, Protein G, affinity tags such as glutathione-S-transferase (GST) or histidine tags. It is within ordinary skill in the art to express the heavy chain and the light chain from a single expression vector or from two separate expression vectors. III. Antibody Modifications Methods for reducing or eliminating the antigenicity of antibodies and antibody fragments are known in the art. When the antibodies are to be administered to a human, the antibodies preferably are “humanized” to reduce or eliminate antigenicity in humans. Preferably, each humanized antibody has the same or substantially the same affinity for the antigen as the non-humanized mouse antibody from which it was derived. In one humanization approach, chimeric proteins are created in which mouse immunoglobulin constant regions are replaced with human immunoglobulin constant regions. See, e.g., Morrison et al., 1984, P ROC . N AT . A CAD . S CI . 81:6851-6855, Neuberger et al., 1984, N ATURE 312:604-608; U.S. Pat. No. 6,893,625 (Robinson); U.S. Pat. No. 5,500,362 (Robinson); and U.S. Pat. No. 4,816,567 (Cabilly). In an approach known as CDR grafting, the CDRs of the light and heavy chain variable regions are grafted into frameworks from another species. For example, murine CDRs can be grafted into human FRs. In some embodiments, the CDRs of the light and heavy chain variable regions of an anti-GDF15 antibody are grafted into human FRs or consensus human FRs. To create consensus human FRs, FRs from several human heavy chain or light chain amino acid sequences are aligned to identify a consensus amino acid sequence. CDR grafting is described in U.S. Pat. No. 7,022,500 (Queen); U.S. Pat. No. 6,982,321 (Winter); U.S. Pat. No. 6,180,370 (Queen); U.S. Pat. No. 6,054,297 (Carter); U.S. Pat. No. 5,693,762 (Queen); U.S. Pat. No. 5,859,205 (Adair); U.S. Pat. No. 5,693,761 (Queen); U.S. Pat. No. 5,565,332 (Hoogenboom); U.S. Pat. No. 5,585,089 (Queen); U.S. Pat. No. 5,530,101 (Queen); Jones et al. (1986) N ATURE 321: 522-525; Riechmann et al. (1988) N ATURE 332: 323-327; Verhoeyen et al. (1988) S CIENCE 239: 1534-1536; and Winter (1998) F EBS L ETT 430: 92-94. In an approach called “SUPERHUMANIZATION™,” human CDR sequences are chosen from human germline genes, based on the structural similarity of the human CDRs to those of the mouse antibody to be humanized. See, e.g., U.S. Pat. No. 6,881,557 (Foote); and Tan et al., 2002, J. I MMUNOL . 169:1119-1125. Other methods to reduce immunogenicity include “reshaping,” “hyperchimerization,” and “veneering/resurfacing.” See, e.g., Vaswami et al., 1998, A NNALS OF A LLERGY , A STHMA , & I MMUNOL . 81:105; Roguska et al., 1996, P ROT . E NGINEER 9:895-904; and U.S. Pat. No. 6,072,035 (Hardman). In the veneering/resurfacing approach, the surface accessible amino acid residues in the murine antibody are replaced by amino acid residues more frequently found at the same positions in a human antibody. This type of antibody resurfacing is described, e.g., in U.S. Pat. No. 5,639,641 (Pedersen). Another approach for converting a mouse antibody into a form suitable for medical use in humans is known as ACTIVMAB™ technology (Vaccinex, Inc., Rochester, N.Y.), which involves a vaccinia virus-based vector to express antibodies in mammalian cells. High levels of combinatorial diversity of IgG heavy and light chains are said to be produced. See, e.g., U.S. Pat. No. 6,706,477 (Zauderer); U.S. Pat. No. 6,800,442 (Zauderer); and U.S. Pat. No. 6,872,518 (Zauderer). Another approach for converting a mouse antibody into a form suitable for use in humans is technology practiced commercially by KaloBios Pharmaceuticals, Inc. (Palo Alto, Calif.). This technology involves the use of a proprietary human “acceptor” library to produce an “epitope focused” library for antibody selection. Another approach for modifying a mouse antibody into a form suitable for medical use in humans is HUMAN ENGINEERING™ technology, which is practiced commercially by XOMA (US) LLC. See, e.g., PCT Publication No. WO 93/11794 and U.S. Pat. No. 5,766,886 (Studnicka); U.S. Pat. No. 5,770,196 (Studnicka); U.S. Pat. No. 5,821,123 (Studnicka); and U.S. Pat. No. 5,869,619 (Studnicka). Any suitable approach, including any of the above approaches, can be used to reduce or eliminate human immunogenicity of an antibody. In addition, it is possible to create fully human antibodies in mice. Fully human mAbs lacking any non-human sequences can be prepared from human immunoglobulin transgenic mice by techniques referenced in, e.g., Lonberg et al., N ATURE 368:856-859, 1994; Fishwild et al., N ATURE B IOTECHNOLOGY 14:845-851, 1996; and Mendez et al., N ATURE G ENETICS 15:146-156, 1997. Fully human mAbs can also be prepared and optimized from phage display libraries by techniques referenced in, e.g., Knappik et al., J. M OL . B IOL . 296:57-86, 2000; and Krebs et al., J. Immunol. Meth. 254:67-84 2001). IV. Therapeutic Uses The antibodies disclosed herein can be used to treat a variety of disorders, for example, cachexia and/or sarcopenia. In some embodiments, the antibodies disclosed herein (e.g., 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) are used to inhibit the loss of muscle mass, for example, the loss of muscle mass associated with an underlying disease. Underlying diseases associated with cachexia include, but are not limited to, cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis. In some embodiments, the disclosed antibodies inhibit loss of muscle mass by at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%. In some embodiments, a loss of muscle mass is accompanied by a loss of fat mass. The antibodies disclosed herein (e.g., 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) may inhibit loss of fat mass by at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%. In other embodiments, the antibodies disclosed herein (e.g., 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) are used to treat one or more features accompanying cachexia and/or sarcopenia, e.g., involuntary body weight loss. In some embodiments, the antibodies revert involuntary body weight loss by at least 2%, 5%, 10%, 15%, 20%, 25%, 30% or 35%. In another embodiment, the antibodies disclosed herein (e.g., 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) are used to inhibit loss of organ mass, for example, loss of organ mass associated with an underlying disease. Underlying diseases associated with cachexia include, but are not limited to, cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis. In some embodiments, the disclosed antibodies inhibit loss of organ mass by at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%. In some embodiments, loss of organ mass is observed in heart, liver, kidney, and/or spleen. In some embodiments, the loss of organ mass in accompanied by a loss of muscle mass, a loss of fat mass and/or involuntary weight loss. Antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11 can be used in therapy. For example, antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11 can be used to treat cachexia and/or sarcopenia. Use of antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11 to treat cachexia and/or sarcopenia in a mammal comprises administering to the mammal a therapeutically effective amount of the antibody. Sarcopenia, muscle wasting disorders and significant muscle weight loss may occur in the absence of cachexia, decreased appetite or body weight loss. In certain embodiments, therefore, one or more of the anti-GDF antibodies of the invention (for example, antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11, or 17B11) can be used to treat a subject suffering from, or who has been diagnosed with, sarcopenia, a muscle wasting disorder and/or significant muscle weight loss, whether or not the subject has, or has been diagnosed with, cachexia or decreased appetite. Such a method comprises administering a therapeutically effective amount of one or more antibodies of the invention to the subject in need thereof. The Fc-rhGDF15 fusion proteins disclosed herein can be used to treat obesity. In some embodiments, the hFc-rhGDF15 fusion proteins disclosed herein are used to inhibit weight gain or to reduce body weight by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45% or 50%. Use of an hFc-hGDF15 fusion protein to treat obesity in a mammal comprises administering to the mammal a therapeutically effective amount of the fusion protein. As used herein, “treat,” “treating” and “treatment” mean the treatment of a disease in a mammal, e.g., in a human. This includes: (a) inhibiting the disease, i.e., arresting its development; and (b) relieving the disease, i.e., causing regression of the disease state. Generally, a therapeutically effective amount of an active component (e.g., an antibody or a fusion protein) is in the range of 0.1 mg/kg to 100 mg/kg, e.g., 1 mg/kg to 100 mg/kg, e.g., 1 mg/kg to 10 mg/kg, e.g., 2.0 mg/kg to 10 mg/kg. The amount administered will depend on variables such as the type and extent of disease or indication to be treated, the overall health of the patient, the in vivo potency of the antibody or fusion protein, the pharmaceutical formulation, the serum half-life of the antibody or fusion protein, and the route of administration. The initial dosage can be increased beyond the upper level in order to rapidly achieve the desired blood-level or tissue level. Alternatively, the initial dosage can be smaller than the optimum, and the dosage may be progressively increased during the course of treatment. Human dosage can be optimized, e.g., in a conventional Phase I dose escalation study designed to run from 0.5 mg/kg to 20 mg/kg. Dosing frequency can vary, depending on factors such as route of administration, dosage amount, serum half-life of the antibody or fusion protein, and the disease being treated. Exemplary dosing frequencies are once per day, once per week and once every two weeks. In some embodiments, dosing is once every two weeks. A preferred route of administration is parenteral, e.g., intravenous infusion. Formulation of monoclonal antibody-based drugs and fusion protein-based drugs are within ordinary skill in the art. In some embodiments, the antibody or fusion protein is lyophilized, and then reconstituted in buffered saline, at the time of administration. The effective amount of a second active agent, for example, an anti-cancer agent or the other agents discussed below, will also follow the principles discussed hereinabove and will be chosen so as to elicit the required therapeutic benefit in the patient. For therapeutic use, an antibody preferably is combined with a pharmaceutically acceptable carrier. As used herein, “pharmaceutically acceptable carrier” means buffers, carriers, and excipients suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. The carrier(s) should be “acceptable” in the sense of being compatible with the other ingredients of the formulations and not deleterious to the recipient. Pharmaceutically acceptable carriers include buffers, solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is known in the art. Pharmaceutical compositions containing antibodies or fusion proteins, such as those disclosed herein, can be presented in a dosage unit form and can be prepared by any suitable method. A pharmaceutical composition should be formulated to be compatible with its intended route of administration. Examples of routes of administration are intravenous (IV), intradermal, inhalation, transdermal, topical, transmucosal, and rectal administration. A preferred route of administration for monoclonal antibodies is IV infusion. Useful formulations can be prepared by methods known in the pharmaceutical art. For example, see Remington's Pharmaceutical Sciences, 18th ed. (Mack Publishing Company, 1990). Formulation components suitable for parenteral administration include a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfate; chelating agents such as EDTA; buffers such as acetates, citrates or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). The carrier should be stable under the conditions of manufacture and storage, and should be preserved against microorganisms. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol), and suitable mixtures thereof. Pharmaceutical formulations preferably are sterile. Sterilization can be accomplished, for example, by filtration through sterile filtration membranes. Where the composition is lyophilized, filter sterilization can be conducted prior to or following lyophilization and reconstitution. In addition to the GDF15 (i.e., MIC-1/PLAB/PDF/NAG-1) pathway, other cytokines implicated in cachexia include Activin A and IL-6. Increased activin levels have been associated with cancer-associated cachexia and gonadal tumors. See, e.g., Marino et al. (2013) C YTOKINE & G ROWTH F ACTOR R EV . 24:477-484. Activin A is a member of the TGF-beta family, and is a ligand of the activin type 2 receptor, ActRIIB. See, e.g., Zhou et al. (2010) C ELL 142:531-543. Circulating levels of IL-6 have been shown to correlate with weight loss in cancer patients, as well as with reduced survival. See, e.g., Fearon et al. (2012) C ELL M ETABOLISM 16:153-166. Accordingly, in certain embodiments of the present invention, one or more inhibitors of Activin-A or the Activin-A receptor, ActRIIB, IL-6 or the IL-6 receptor (IL-6R), may be administered in combination with (for example, administered at the same time as, administered before, or administered after) an antibody of the present invention that inhibits GDF-15 activity. Exemplary inhibitors of Activin A or ActRIIB, include, for example, an anti-Activin-A antibody or an antigen binding fragment thereof, an anti-ActRIIB antibody or an antigen binding fragment thereof, a small molecule inhibitor of Activin-A, a small molecule inhibitor of ActRIIB, and a ‘decoy’ receptor of ActRIIB, such as a soluble ActRIIB receptor and a fusion of the soluble ActRIIB receptor with an Fc molecule (ActRIIB-Fc). See, for example, Zhou et al. (2010), supra. Suitable inhibitors of IL-6 or IL-6R, include an anti-IL-6 antibody or an antigen binding fragment thereof, an anti-IL-6R antibody or an antigen binding fragment thereof, a small molecule inhibitor of IL-6, a small molecule inhibitor of IL-6R, and a ‘decoy’ receptor of IL-6R, such as a soluble IL-6 receptor and a fusion of the soluble IL-6 receptor with an Fc molecule (IL6R-Fc). See, e.g., Enomoto et al. (2004) B IOCHEM . A ND B IOPHYS . R ES . C OMM . 323:1096-1102; Argiles et al. (2011) E UR . J. P HARMACOL . 668:S81-S86; Tuca et al. (2013) O NCOLOGY /H EMATOLOGY 88:625-636. Suitable inhibitors of IL-6 or IL-6R may include, for example, Tocilizumab (Actemra®, Hoffmann-LaRoche), a humanized anti-IL-6R monoclonal antibody approved for treatment of rheumatoid arthritis, and Sarilumab/REGN88 (Regeneron), a humanized anti-IL6R antibody in clinical development for treatment of rheumatoid arthritis; and Selumetinib/AZD6244 (AstraZeneca), an allosteric inhibitor of MEK, which has been shown to inhibit IL-6 production. Prado et al. (2012) B RITISH J. C ANCER 106:1583-1586. TNFα and IL-1 are cytokines known to be involved in mediation of the proinflammatory response, which are also implicated in muscle depletion, anorexia and cachexia. Increased circulating levels of TNFα appear to inhibit myogenesis. TNFα, also known as “cachectin,” stimulates interleukin-1 secretion and is implicated in the induction of cachexia. IL-1 is a potent trigger of the acute-phase inflammatory response, and it has been shown that infusion of IL-1 can lead to marked weight loss and appetite loss. IL-1 has been shown to contribute to the initiation of cancer cachexia in mice bearing a murine colon-26 adenocarcinoma (Strassmann et al. (1993) J. I MMUNOL . 150:2341). See also, Mathys and Billiau (1997) N UTRITION 13:763-770; Fong et al. (1989) A M . J. P HYSIOL —R EGULATORY , I NTEGRATIVE A ND C OMPARATIVE P HYSIOL , 256:R659-R665. Thus, TNFα inhibitors and IL-1 inhibitors that are used in the treatment of rheumatoid arthritis may also be useful in the treatment of cachexia. Accordingly, in certain embodiments of the present invention, one or more inhibitors of TNFα or IL-1 may be administered in combination with (for example, administered at the same time as, administered before, or administered after) an antibody of the present invention that inhibits GDF-15 activity. Suitable inhibitors of TNFα or IL-1 include an anti-TNFα antibody or an antigen binding fragment thereof, an anti-IL-1 antibody or an antigen binding fragment thereof, a small molecule inhibitor of TNFα or IL-1, and a ‘decoy’ receptor of TNFα or IL-1, such as a soluble TNFα or IL-1 receptor and a fusion of the soluble form of TNFα or IL-1 with an Fc molecule. Suitable inhibitors of TNFα include for example, etanercept (Enbrel®, Pfizer/Amgen), infliximab (Remicade®, Janssen Biotech), adalimumab (Humira®, Abbvie), golimumab (Simponi®, Johnson and Johnson/Merck), and certolizumab pegol (Cimzia®, UCB). Suitable IL-1 inhibitors include, for example, Xilonix® antibody that targets IL-1α (XBiotech), anikinra (Kinaret®, Amgen), canakinumab (Ilaris®, Novartis), and rilonacept (Arcalyst®, Regeneron). In certain embodiments, the TNFα inhibitor or IL-1 inhibitor, which is typically administered systemically for the treatment of rheumatoid arthritis may be administered locally and directly to the tumor site. Myostatin, also known as GDF-8, is a member of the TGF-β family of peptides that is a negative regulator of muscle mass, as shown by increased muscle mass in myostatin deficient mammals. Myostatin is a ligand of the activin type 2 receptor, ActRIIB. Accordingly, in certain embodiments of the present invention, one or more inhibitors of myostatin or its receptor may be administered in combination with (for example, administered at the same time as, administered before, or administered after) an antibody of the invention that inhibits GDF-15 activity. Suitable inhibitors of myostatin or ActRIIB, include an anti-myostatin antibody or an antigen binding fragment thereof, an anti-ActRIIB antibody or an antigen binding fragment thereof, a small molecule inhibitor of myostatin, a small molecule inhibitor of ActRIIB, and a ‘decoy’ receptor of GDF-8, such as a soluble ActRIIB and a fusion of the soluble form of ActRIIB with an Fc molecule. See, e.g., Lokireddy et al. (2012) B IOCHEM . J. 446(1):23-26. Myostatin inhibitors that may be suitable for the present invention include REGN1033 (Regeneron); see Bauerlein et al. (2013) J. C ACHEXIA S ARCOPENIA M USCLE : Abstracts of the 7 th Cachexia Conference, Kobe/Osaka, Japan, Dec. 9-11, 2013, Abstract 4-06; LY2495655 (Lilly), a humanized anti-myostatin antibody in clinical development by Eli Lilly; see also “A P HASE 2 S TUDY O F LY2495655 I N P ARTICIPANTS W ITH P ANCREATIC C ANCER ,” available on the world wide web at clinicaltrials.gov/ct2/NCT01505530; NML identifier: NCT01505530; ACE-031 (Acceleron Pharma); and stamulumab (Pfizer). Agents such as Ghrelin or ghrelin mimetics, or other growth hormone secretagogues (GHS) which are able to activate the GHS receptor (GHS-R1a), also known as the ghrelin receptor, may be useful for increasing food intake and body weight in humans. See Guillory et al. (2013) in V ITAMINS A ND H ORMONES vol. 92, chap. 3; and Steinman and DeBoer (2013) V ITAMINS A ND H ORMONES vol. 92, chap. 8. Suitable ghrelin mimetics include anamorelin (Helsinn, Lugano, CH); See Temel et al. (2013) J. C ACHEXIA S ARCOPENIA M USCLE : Abstracts of the 7 th Cachexia Conference, Kobe/Osaka, Japan, Dec. 9-11, 2013, Abstract 5-01. Other suitable GHS molecules can be identified, for example, using the growth hormone secretagogue receptor Ghrelin competition assay described in PCT Publication Nos. WO2011/117254 and WO2012/113103. Agonists of the androgen receptor, including small molecules and other selective androgen receptor modulators (SARMs) may be useful in treating cachexia and/or sarcopenia. See, e.g., Mohler et al. (2009) J. M ED . C HEM . 52:3597-3617; Nagata et al. (2011) B IOORGANIC A ND M ED . C HEM . L ETTERS 21:1744-1747; and Chen et al. (2005) M OL . I NTERV . 5:173-188. Ideally, SARMs should act as full agonists, like testosterone, in anabolic target tissues, such as muscle and bone, but should demonstrate only partial or pure androgen receptor antagonistic activities on prostate tissue. See, e.g., Bovee et al. (2010) J. S TEROID B IOCHEM . & M OL . B IOL . 118:85-92. Suitable SARMs can be identified, for example, by use of the methods and assays described in Zhang et al. (2006) B IOORG . M ED . C HEM . L ETT . 16:5763-5766; and Zhang et al. (2007) B IOORG . M ED . C HEM . L ETT . 17:439-443. Suitable SARMs include, for example, GTx-024 (enobosarm, Ostarine®, GTx, Inc.), a SARM in phase II clinical development by GTx, Inc. See also, Dalton et al. (2011) J. C ACHEXIA S ARCOPENIA M USCLE 2:153-161. Other suitable SARMs include 2-(2,2,2)-trifluoroethyl-benzimidazoles (Ng et al. (2007) B IOORG . M ED . C HEM . L ETT . 17:1784-1787) and JNJ-26146900 (Allan et al. (2007) J. S TEROID B IOCHEM . & M OL . B IOL . 103:76-83). β-adrenergic receptor blockers, or beta-blockers, have been studied for their effect on body weight in cachexic subjects, and have been associated with partial reversal of cachexia in patients with congestive heart failure. See, e.g., Hryniewicz et al. (2003) J. C ARDIAC F AILURE 9:464-468. Beta-blocker MT-102 (PsiOxus Therapeutics, Ltd.) has been evaluated in a phase 2 clinical trial for subjects with cancer cachexia. See Coats et al. (2011) J. C ACHEXIA S ARCOPENIA M USCLE 2:201-207. Melanocortin receptor-knockout mice with a genetic defect in melanocortin signaling exhibit a phenotype opposite that of cachexia: increased appetite, increased lean body mass, and decreased metabolism. Thus, melanocortin antagonism has emerged as a potential treatment for cachexia associated with chronic disease (DeBoer and Marks (2006) T RENDS I N E NDOCRINOLOGY A ND M ETABOLISM 17:199-204). Accordingly, in certain embodiments of the present invention, one or more inhibitors of a melanocortin peptide or a melanocortin receptor may be administered in combination (for example, administered at the same time as, administered before, or administered after) with an antibody of the invention that inhibits GDF-15 activity. Suitable inhibitors of melanocortins or melanocortin receptors include an anti-melanocortin peptide antibody or an antigen binding fragment thereof, an anti-melanocortin receptor antibody or an antigen binding fragment thereof, a small molecule inhibitor of a melanocortin peptide, a small molecule inhibitor of a melanocortin receptor, and a ‘decoy’ receptor of a melanocortin receptor, such as soluble melanocortin receptor and a fusion of a soluble melanocortin receptor with an Fc molecule. Suitable melacortin receptor inhibitors include, for example, the melanocortin receptor antagonist agouri-related peptide (AgRP(83-132)), which has been demonstrated to prevent cachexia-related symptoms in a mouse model of cancer-related cachexia (Joppa et al. (2007) P EPTIDES 28:636-642). Anti-cancer agents, especially those that can cause cachexia and elevate GDF-15 levels, such as cisplatin, may be used in methods of the present invention in combination with (for example, administered at the same time as, administered before, or administered after) an anti-GDF-15 antibody of the invention. Many cancer patients are weakened by harsh courses of radio- and/or chemotherapy, which can limit the ability of the patient to tolerate such therapies, and hence restrict the dosage regimen. Certain cancer agents themselves, such as fluorouracil, Adriamycin, methotrexate and cisplatin, may contribute to cachexia, for example by inducing severe gastrointestinal complications. See, e.g., Inui (2002) C ANCER J. F OR C LINICIANS 52:72-91. By the methods of the present invention, in which an anti-cancer agent is administered in combination with an anti-GDF-15 antibody of the invention, it is possible to decrease the incidence and/or severity of cachexia, and ultimately increase the maximum tolerated dose of such an anti-cancer agent. Accordingly, efficacy of treatment with anti-cancer agents that may cause cachexia can be improved by reducing the incidence of cachexia as a dose-limiting adverse effect, and by allowing administration of higher doses of a given anti-cancer agent. Thus, the present invention includes pharmaceutical compositions comprising an anti-GDF-15 antibody of the present invention in combination with an agent selected from the group consisting of: an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-R1a agonist, a SARM, a TNFα inhibitor, an IL-1α inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, a melanocortin receptor inhibitor, and an anti-cancer agent. The present invention also includes methods of treating, preventing or minimizing cachexia and/or sarcopenia in a mammal comprising administering to a mammal in need thereof a pharmaceutical composition or compositions comprising an effective amount of an anti-GDF-15 antibody of the invention in combination with an effective amount of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-R1α agonist, a SARM, a TNFα inhibitor, an IL-1α inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, or a melanocortin receptor inhibitor. In another embodiment, the invention comprises a method of inhibiting loss of muscle mass associated with an underlying disease comprising administering to a mammal in need thereof a pharmaceutical composition or compositions comprising an effective amount of an anti-GDF-15 antibody of the invention in combination with an effective amount of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-R1α agonist, a SARM, a TNFα inhibitor, an IL-1α inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, or a melanocortin receptor inhibitor to prevent or reduce loss of muscle mass. The underlying disease may be selected from the group consisting of cancer, chronic heart failure, chronic kidney disease, COPD, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis. Additionally, in certain embodiments, the loss of muscle mass is accompanied by a loss of fat mass. In yet further embodiments, the present invention comprises a method of inhibiting or reducing involuntary weight loss in a mammal comprising administering to a mammal in need thereof a pharmaceutical composition or pharmaceutical compositions comprising an effective amount of an anti-GDF-15 antibody of the invention in combination with an effective amount of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-R1α agonist, a SARM, a TNFα inhibitor, a IL-1α inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, or a melanocortin receptor inhibitor. Certain anti-cancer agents, such as cisplatin, have one or more undesirable adverse effects that involve causing or increasing one or more syndromes such as cachexia, sarcopenia, muscle wasting, bone wasting or involuntary body weight loss. Accordingly, in certain embodiments, the present invention comprises a method of treating cancer, while preventing, minimizing or reducing the occurrence, frequency or severity of cachexia, sarcopenia, or muscle wasting, bone wasting or involuntary loss of body weight in a mammal, comprising administering to a mammal in need thereof a pharmaceutical composition comprising an effective amount of an anti-GDF-15 antibody of the present invention in combination with one or more anti-cancer agents. In particular embodiments, the invention comprises a method of treating cancer, while preventing, minimizing or reducing the occurrence, frequency or severity of cachexia, sarcopenia or muscle wasting, bone wasting or involuntary loss of body weight in a mammal, comprising administering to a mammal in need thereof a pharmaceutical composition comprising an effective amount of an anti-GDF-15 antibody of the invention in combination with one or more anti-cancer agents known to cause or increase the occurrence, frequency or severity of cachexia, sarcopenia, or muscle wasting, bone wasting or involuntary loss of body weight in a mammal. EXAMPLES The following Examples are merely illustrative and are not intended to limit the scope or content of the invention in any way. Example 1 Human GDF15 Serum Levels in Mouse Xenograft Tumor Models In this example, the amount of hGDF15 in the serum of mice bearing various xenograft tumors was measured. Serum was collected from three mice for each of the following tumor xenograft models: Chago, RPMI7951, PC3, TOV21G, HT-1080, K-562, and LS1034. Serum was also collected from three naïve mice as a control. Human GDF15 serum levels were determined by ELISA (R&D Systems, Cat. No. DY957E). Mice bearing human xenograft tumors that induce cachexia had serum levels of hGDF15 above 2 ng/mL, while mice bearing human xenograft tumors that do not induce cachexia had serum levels of hGDF15 below 1 ng/mL ( FIG. 2 ). Naïve mice had no detectable hGDF15 (control). These results indicate that a serum level of approximately 2 ng/mL GDF15 is a threshold for inducing cachexia in this mouse model. Similar levels of hGDF15 were also observed in plasma when determined by ELISA. Example 2 Non-Tumor Bearing Mouse Model of Cachexia An existing non-tumor bearing mouse model of cachexia is based on the injection of mature rhGDF15 into a mouse (Johnen et al. (1997) N AT . M ED . 13:1333-1340). Mature rhGDF15 corresponds to amino acids 197 to 308 of hGDF15 protein. Mature rhGDF15 can be produced in the yeast Pichia pastoris as described in Fairlie et al. (2000) G ENE 254:67-76). Cleaved-rhGDF15 corresponds to amino acids 197 to 308 of hGDF15 protein released from an Fc-rhGDF15 fusion protein. In FIGS. 3-4 described below, cleaved-rhGDF15 was produced by enzymatic digestion of mFc-rhGDF15 fusion protein with Factor Xa, and subsequent purification, prior to injection in mice. To investigate the half-life of cleaved-rhGDF15, plasma was collected from a group of three mice after single dose of cleaved-rhGDF15 (1 μg/g) at different time points (2, 5, 8, 11, and 23 hours). Human GDF15 plasma levels were determined by ELISA (R&D Systems, Cat. No. DY957E). As shown in FIG. 3 , cleaved-rhGDF15 was rapidly cleared from the plasma following injection. Eleven hours post-injection, the amount of cleaved-rhGDF15 in the plasma was below 10 ng/mL, and, within 23-hours, cleaved-rhGDF15 was almost completely cleared from the plasma. The rapid clearance of cleaved-rhGDF15 in non-tumor bearing mice was further investigated. Eight-week old female ICR-SCID mice were randomized into two groups of ten mice each. Mice were dosed subcutaneously into the flank every eight hours for three days (a total of nine doses) with one of the following treatments: PBS (control) or cleaved-rhGDF15 at 1 μg/g. Body weight was measured daily. Statistical analyses were performed using a two-way ANOVA. As shown in FIG. 4 , cleaved-rhGDF15 induced body weight loss. After nine doses over a three day period, percent body weight dropped to 88% at day 4 (p<0.001), but approximately 24 hours after the last dose the mice began to gain weight. On day 6, the last day of the experiment, percent body weight increased to 94.8 percent (p<0.001). These results indicate that weight loss induced by cleaved-rhGDF15 is not sustained over long periods of time. The activity observed with cleaved-rhGDF15 described herein was similar to that observed with mature rhGDF15 in the existing mouse model (Johnen et al., supra). The existing non-tumor bearing mouse model for cachexia relies on the injection of large amounts of mature rhGDF15 delivered in multiple doses per day to induce muscle loss and body weight loss (Johnen et al., supra). It appears that if mature rhGDF15 or cleaved-rhGDF15 is used, the mice do not sustain muscle weight loss or body weight loss for long periods of time without continuous dosing. This limits the usefulness of such models. Moreover, repeated dosing requires frequent handling of these mice which introduces stress that can compromise the reliability of body weight loss measurements. For example, as shown in FIG. 4 , mice treated with multiple doses of PBS demonstrated a body weight drop due to the stress of repeated dosing and handling. Example 3 GDF15 Fusion Proteins In view of the large amounts of mature rhGDF15 (or cleaved-rhGDF15) and the labor intensity required to induce non-tumor bearing cachexia mouse models (as well as the resulting limitations of these models), we investigated alternate forms of rhGDF15 to induce a cachetic phenotype in mice. This Example describes the construction and production of two fusion proteins consisting of GDF15 and an immunoglobulin Fc fragment, designated mFc-rhGDF15 (mouse IgG1 Fc fused to the amino terminus of mature human GDF15) and rFc-rmGDF15 (rabbit IgG1 Fc fused to the amino terminus of mature mouse GDF15). The GDF15 fusion proteins were designed using methods known in the art. The mFc-rhGDF15 DNA sequences were constructed from fragments using overlap extension PCR to include (in the following order): 5′ HindIII restriction site, Kozak consensus sequence, amino terminal signal sequence, mouse IgG1 Fc, Factor Xa cleavage site, a polypeptide linker (GGGGS) (SEQ ID NO: 139), mature hGDF15, stop codon, and a 3′ EcoRI restriction site. The rFc-rmGDF15 amino acid sequences were converted to codon-optimized DNA sequences and synthesized to include (in the following order): 5′ HindIII restriction site, Kozak consensus sequence, amino terminal signal sequence, rabbit IgG1 Fc, a polypeptide linker (GGGG) (SEQ ID NO: 265), mature mouse GDF15, stop codon, and a 3′ EcoRI restriction site. The GDF15 fusion proteins were subcloned into the mammalian expression vector pEE14.4 (Lonza, Basel, Switzerland) via HindIII and EcoRI sites using In-Fusion™ PCR cloning (Clontech, Mountain View, Calif.). GDF15 fusion proteins were stably expressed in CHOK1SV cells using the GS System™ (Lonza Biologics) in order to produce large quantities of purified protein. Each expression vector was linearized and transfected into CHOK1SV cells. Stable clones were selected in the presence of methionine sulfoximine. Secreted proteins produced by CHOK1SV stably transfected cell lines were purified by Protein A and size exclusion chromatography. The nucleic acid sequence and the encoded protein sequence defining the mouse IgG1 Fc-mature human GDF15 fusion protein (mFc-rhGDF15) are shown below. mFc-rhGDF15 contains mouse IgG1 Fc from amino acids 1-222, Factor Xa cleavage site from amino acids 223-228, an artificial linker sequence from amino acids 229-233, and mature hGDF15 from amino acids 234-345. Nucleic Acid Sequence Encoding the Mouse IgG1 Fc—Mature Human GDF15 Fusion Protein (mFc-rhGDF15) (SEQ ID NO:219) 1gggtgtaaac cctgcatctg cacggtgccg gaggtgtcctccgtctttat cttccctccc61aaacccaagg atgtgctgac aatcactttg actccaaaagtcacatgcgt agtcgtggac121atctcgaaag acgacccgga agtgcagttc tcgtggtttgttgatgatgt agaagtgcat181accgctcaaa cccagccgag ggaagaacag tttaacagcacgtttaggag tgtgtcggaa241ctgcccatta tgcaccagga ttggcttaat gggaaggagttcaaatgtcg cgtgaatagt301gcggcgttcc cagcccctat tgaaaagact atttccaaaacgaagggtcg gcccaaagct361ccccaagtat acacaatccc tccgccgaaa gaacaaatggcaaaagacaa agtgagtttg421acgtgcatga tcacggactt tttcccggag gatatcaccgtcgaatggca atggaatggg481caacctgccg aaaactacaa gaatacacaa cccattatggataccgatgg atcgtatttc541gtctactcaa agttgaacgt acagaagtca aattgggaggcagggaatac gttcacttgc601agtgttttgc acgaaggcct ccataaccac catacggaaaagtcactgtc gcactccccg661ggaaaaatcg agggcagaat ggatggtgga ggagggtcggcgcgcaacgg ggaccactgt721ccgctcgggc ccgggcgttg ctgccgtctg cacacggtccgcgcgtcgct ggaagacctg781ggctgggccg attgggtgct gtcgccacgg gaggtgcaagtgaccatgtg catcggcgcg841tgcccgagcc agttccgggc ggcaaacatg cacgcgcagatcaagacgag cctgcaccgc901ctgaagcccg acacggtgcc agcgccctgc tgcgtgcccgccagctacaa tcccatggtg961ctcattcaaa agaccgacac cggggtgtcg ctccagacctatgatgactt gttagccaaa1021gactgccact gcata Protein Sequence Defining the Mouse IgG1 Fc—Mature Human GDF15 Fusion Protein (mFc-rhGDF15) (SEQ ID NO:220) 1gckpcictvp evssvfifpp kpkdvltitl tpkvtcvvvdiskddpevqf swfvddvevh61taqtqpreeq fnstfrsvse lpimhqdwln gkefkcrvnsaafpapiekt isktkgrpka121pqvytipppk eqmakdkvsl tcmitdffpe ditvewqwngqpaenykntq pimdtdgsyf181vysklnvqks nweagntftc svlheglhnh htekslshspgkiegrmdgg ggsarngdhc241plgpgrccrl htvrasledl gwadwvlspr evqvtmcigacpsqfraanm haqiktslhr301lkpdtvpapc cvpasynpmv liqktdtgvs lqtyddllakdchci The nucleic acid sequence and the encoded protein sequence defining the rabbit IgG1 Fc-mature mouse GDF15 fusion protein (rFc-rmGDF15) are shown below. rFc-rmGDF15 contains rabbit IgG1 Fc from amino acids 1-223, an artificial linker sequence from amino acids 224-227, and mature mouse GDF15 from amino acids 228-342. Nucleic Acid Sequence Encoding the Rabbit IgG1 Fc—Mature Mouse GDF15 Fusion Protein (rFc-rmGDF15) (SEQ ID NO:221) 1tcgaaaccca cttgccctcc tccggagctg ttgggcggaccctccgtgtt tatctttccc61ccgaagccga aagataccct tatgatctca cggacgccggaggtcacttg cgtagtagtg121gatgtgtcgg aggatgaccc cgaagtccag ttcacctggtatatcaataa cgagcaagtg181aggacagcga ggcccccact tagggagcag cagttcaactccacaattcg ggtcgtcagc241actttgccca tcgctcatga ggactggctc cgcggaaaagagttcaagtg taaggtgcat301aacaaggcat tgccagcgcc tattgaaaag acaatctcgaaggcgcgagg gcagccgctc361gagcccaaag tgtatacgat gggacccccg agggaagaattgtcgtcgcg ctcagtaagc421cttacgtgca tgattaacgg tttctaccct agcgacatcagcgtagagtg ggaaaagaat481ggaaaggcgg aggataacta caagacgact cccgcggtgctggattcgga tgggtcgtac541tttctgtata gcaaattgtc agtcccgacc tcagaatggcagaggggtga cgtgttcacg601tgctccgtga tgcacgaagc acttcacaat cactacacccagaaatcaat ctcgcggtcc661ccaggcaaag gtggaggagg gtcggctcac gcccaccctcgcgattcgtg tccgctgggg721cctggtagat gctgtcatct cgagacagtc caggccacgctggaggacct cgggtggtca781gactgggtcc tgtccccacg acaactgcag ctttcgatgtgcgtggggga atgtccgcac841ttgtacagat cggcgaatac ccacgctcag attaaggcacgactccatgg tttgcagcca901gataaagtcc ccgcaccttg ctgtgtcccc agctcatatactcctgtcgt actcatgcat961cggacagaca gcggcgtgtc gcttcaaacg tatgacgacctcgtagcgag aggatgtcat1021tgcgcc Protein Sequence Defining the Rabbit IgG1 Fc—Mature Mouse GDF15 Fusion Protein (rFc-rmGDF15) (SEQ ID NO:222) 1skptcpppel lggpsvfifp pkpkdtlmis rtpevtcvvvdvseddpevq ftwyinneqv61rtarpplreq qfnstirvvs tlpiahedwl rgkefkckvhnkalpapiek tiskargqpl121epkvytmgpp reelssrsvs ltcmingfyp sdisvewekngkaednyktt pavldsdgsy181flysklsvpt sewqrgdvft csvmhealhn hytqksisrspgkggggsah ahprdscplg241pgrcchletv qatledlgws dwvlsprqlq lsmcvgecphlyrsanthaq ikarlhglqp301dkvpapccvp ssytpvvlmh rtdsgvslqt yddlvargchca The following sequences represent exemplary protein sequences for human IgG1 Fe-mature human GDF15 fusion proteins (hFc-rhGDF15). hFc-rhGDF15 Xa consists of human IgG1 Fc from amino acids 1-227, Factor Xa cleavage site from amino acids 228-233, an artificial linker sequence from amino acids 234-238, and mature hGDF15 from amino acids 239-350. hFc-rhGDF15 consists of human IgG1 Fc from amino acids 1-227, an artificial linker sequence from amino acids 228-232, and mature hGDF15 from amino acids 233-344. Protein Sequence Defining the Human IgG1 Fc—Mature Human GDF15 Fusion Protein with Xa Cleavage Site (hFc-hGDF15 Xa) (SEQ ID NO:223) 1dkthtcppcp apellggpsv flfppkpkdt lmisrtpevtcvvvdvshed pevkfnwyvd61gvevhnaktk preeqynsty rvvsvltvlh qdwlngkeykckvsnkalpa piektiskak121gqprepqvyt lppsreemtk nqvsltclvk gfypsdiavewesngqpenn ykttppvlds181dgsfflyskl tvdksrwqqg nvfscsvmhe alhnhytqkslslspgkieg rmdggggsar241ngdhcplgpg rccrlhtvra sledlgwadw vlsprevqvtmcigacpsqf raanmhaqik301tslhrlkpdt vpapccvpas ynpmvliqkt dtgvslqtyddllakdchci Protein Sequence Defining the Human IgG1 Fc—Mature Human GDF15 Fusion Protein with (hFc-hGDF15) (SEQ ID NO:224) 1dkthtcppcp apellggpsv flfppkpkdt lmisrtpevtcvvvdvshed pevkfnwyvd61gvevhnaktk preeqynsty rvvsvltvlh qdwlngkeykckvsnkalpa piektiskak121gqprepqvyt lppsreemtk nqvsltclvk gfypsdiavewesngqpenn ykttppvlds181dgsfflyskl tvdksrwqqg nvfscsvmhe alhnhytqkslslspgkggg gsarngdhcp241lgpgrccrlh tvrasledlg wadwvlspre vqvtmcigacpsqfraanmh aqiktslhrl301kpdtvpapcc vpasynpmvl iqktdtgvsl qtyddllakdchci Example 4 Fc-rhGDF15 Induced Cachexia Model This Example describes the generation of an Fc-GDF15-induced cachexia model in mice Immune-competent (Balb/C) and immune-incompetent (CB17-Scid) mice were randomized into three groups of ten mice each. Each group received one of the following treatments: PBS (control), mFc-rhGDF15 (as described in Example 3), or rFc-rmGDF15 (as described in Example 3) at 1 μg/g. Eight-week old female mice were dosed subcutaneously into the flank for three days (Balb/C) or once (CB17-Scid). Body weight was measured daily. As shown in FIG. 5A and FIG. 5B , administration of mFc-rhGDF15 or rFc-rmGDF15 induced body weight loss in immune-competent mice (FIG. SA) and immune-incompetent mice ( FIG. 5B ). These results indicate that a steady-state level of active rhGDF15 was achieved, because regardless of dose (one vs. three doses), both mFc-rhGDF15 and rFc-rmGDF15 induced sustained weight loss over the measured time course (7 days). The fusion proteins, mFc-rhGDF15 and rFc-rmGDF15, were further tested in additional immune-competent (C57BL6, Swiss Webster) and immune-incompetent (ICR-SCID) mouse strains. In each tested mouse strain, the administration of mFc-rhGDF15 or rFc-rmGDF15 induced cachexia, as measured by body weight loss. Similar results were obtained regardless of whether mFc-rhGDF15 was dosed subcutaneously or intraperitoneally. It was also investigated whether mFc-rhGDF15 induced weight loss regardless of the age of the mice treated with fusion protein. Swiss Webster (immune-competent) female mice of different ages (7, 13 and 25 weeks old) were divided into two groups of ten and treated with three doses per day of mFc-rhGDF15 or PBS (0.8 μg/g, 7 week old mice; 0.6 μg/g, 13 week old mice; or 0.4 μg/g, 25 week old mice). mFc-rhGDF15-induced weight loss was observed in all three mice age populations. In each age population, the mice lost approximately 10% of their body weight following treatment with mFc-rhGDF15 measured at ten days post treatment. In another experiment, mFc-rhGDF15 induction of cachexia was investigated by measuring the loss of body weight, the loss of muscle mass, the loss of fat mass, and the expression levels of two molecular markers indicative of muscle degradation (i.e., mMuRF1 and mAtrogin). MuRF1 and Atrogin are E3-ubquitin ligases that are upregulated in multiple models of muscle atrophy and cachexia (Glass, D. (2010) C URR . O PIN . C LIN . N UTR . M ET . C ARE 13:225-229). Eight-week old female ICR-SCID mice were randomly divided into ten groups of ten mice each. Five groups (ten mice each) were dosed subcutaneously in the flank with PBS (control) and five groups (ten mice each) were dosed subcutaneously in the flank with mFc-rhGDF15 at 1.6 μg/g on day one. Body weight was measured daily for up to 17 days. One control group and one treatment group were sacrificed at different time points (0, 1, 3, 7 and 16 days post dose). Gonadal fat and gastrocnemius muscles were removed surgically from each group of mice at the indicated sacrifice time, and weighed. Tissues were snap frozen in liquid nitrogen, and RNA was isolated from the gastrocnemius muscle samples. Levels of mMuRF1 and mAtrogin mRNA were measured by qRT-PCR in samples corresponding to groups collected after 1, 7, and 16 days post dose. Statistical analyses were performed using a two-way ANOVA. As shown in FIG. 6A , mFc-rhGDF15 induced body weight loss in ICR-SCID mice. Percent body weight was 79.4 percent when measured after 16 days following one dose of mFc-rhGDF15 (p<0.001). mFc-rhGDF15 also induced loss of fat (adipose tissue), as observed by the loss of gonadal fat ( FIG. 6B ; p<0.01 at day 7 and p<0.001 at day 16) and loss of muscle, as observed by the loss of gastrocnemius muscle ( FIG. 6C ; p<0.05 at days 1 and 3, and p<0.0001 at days 7 and 16). Administration of mFc-rhGDF15 also elevated gene expression of two enzymes associated with muscle degradation and cachexia, mMuRF1 ( FIG. 6D ; 6<0.001 at days 1, 7, and 16) and mAtrogin ( FIG. 6E ; p<0.001 at days 1 and 7, and p<0.01 at day 16). These results indicated that mFc-rhGDF15 induces cachexia in mice. Example 5 mFc-rhGDF15 Induces Cachexia with a Longer GDF15 Half-Life in Serum In this Example, the serum hGDF15 levels were measured following administration of mFc-rhGDF15, to determine the half-life of rhGDF15 in this model. Eight-week old female Balb/C nude mice were randomly divided into two groups of twelve mice each. Mice were dosed subcutaneously in the flank every twelve hours for three days (a total of six doses) with one of the following treatments: PBS (control) or mFc-rhGDF15 at 1.33 μg/g. Body weight was measured daily. As shown in FIG. 7 , mFc-rhGDF15 induced sustained body weight loss for at least one week after the final injection. In this experiment, hGDF15 serum levels were measured 0.2, 5, and 8 days after the last dose of mFc-rhGDF15. Mice were sacrificed at the indicated time, and sera were collected. Human GDF15 serum levels were determined by ELISA (R&D Systems, Cat. No. DY957E). Table 1 provides the serum levels (μg/mL) for each mouse in the study. TABLE 1Days postMouseTreatmentSerum GDF15 (μg/mL);last dose#Agentμg/gELISA0.21mFc-rhGDF151.3310.020.22mFc-rhGDF151.339.540.23mFc-rhGDF151.339.3654mFc-rhGDF151.338.2455mFc-rhGDF151.338.0156mFc-rhGDF151.336.5987mFc-rhGDF151.335.6088mFc-rhGDF151.335.5289mFc-rhGDF151.335.57 The results in Table 1 reveal that strong, sustained levels of hGDF15 are present in the serum at least eight days after the last dose of mFc-rhGDF15. Serum samples from day 0.2 and day 5 after the last dose were also analyzed by Western blot (reducing gel; blot with an antibody against hGDF15 (R&D Systems, Cat. No AF957)) and quantified by Licor to determine the stability of mFc-rhGDF15 in the serum. Unexpectedly, two bands were observed. The upper band was approximately 40 kDa, and appeared to be mFc-rhGDF15. The lower band was approximately 15 kDa, and appeared to be cleaved mature rhGDF15. This indicated that mature rhGDF15 was released from mFc-rhGDF15 in the serum. Quantification of the two bands showed that about 90% of the rhGDF15 present in the serum was in the form of mFc-rhGDF15, with about 10% of the total rhGDF15 in the serum being present as the cleaved mature form ( FIG. 8 ). Quantification showed a slight decrease in mFc-rhGDF15 in the serum samples collected five days after the last dose, but, surprisingly, a constant level of mature rhGDF15 remained in the serum. The ratio of mature rhGDF15 to mFc-rhGDF15 slightly increased over time, as a result of a decrease in mFc-rhGDF15 in the serum. Similar results were observed when rFc-rmGDF15 was injected into mice. The results presented in FIGS. 7-8 and Table 1 were unexpected. The expectation was that very little, if any, mature rhGDF15 would be cleaved (released) from the mFc-rhGDF15 by day 0.2, and that any cleaved rhGDF15 would be rapidly cleared from the serum, as had been previously observed. For example, in FIG. 4 , a series of nine doses at 1 μg/g per dose (for a total of 9 μg/g) of cleaved-rhGDF15 was required to induce significant body weight loss in mice. These mice gained weight, almost immediately when dosing stopped. In contrast, a single dose of mFc-rhGDF15 at 0.1 μg/g was sufficient to induce significant body weight loss for at least eight days ( FIG. 9A ; ten ICR-SCID mice dosed intraperitoneally with 0.1 μg/g on day 1). The data in Table 1 revealed that rhGDF15 serum levels were stable for at least eight days, when rhGDF15 was administered as an mFc-rhGDF15 fusion protein. To determine the source of activity resulting in sustained body weight loss, we investigated whether the observed rhGDF15 activity was attributable to the mFc-rhGDF15 fusion protein, the released mature rhGDF15 form, or both. As shown in FIG. 9A , a low dose of mFc-rhGDF15 (0.1 μg/g) resulted in body weight loss continuing for at least eight days. A lower dose of mFc-rhGDF15 (0.01 μg/g) also induced body weight loss, but the effect was not sustained for longer than 3 days post dose. In this experiment, plasma was collected from three mice each dosed with 0.1 μg/g or 0.01 μg/g at 5 days post dose. Total rhGDF15 was measured by ELISA as described above. Total rhGDF15 plasma levels in the mice dosed with 0.1 μg/g were above 70 ng/mL, consistent with the observation that these mice had significant weight loss ( FIG. 9B ). Total rhGDF15 plasma levels in mice dosed with 0.01 μg/g were approximately 3.3 ng/mL, but it was observed that these mice were gaining weight ( FIG. 9A and FIG. 9B ). As described in FIG. 2 , the threshold for hGDF15 to induce cachexia in tumor bearing mice is approximately 2 ng/mL. Thus, if both forms of rhGDF15 were active (i.e., mFc-rhGDF15 and released mature rhGDF15), then these mice should be losing weight, not gaining weight (i.e., 3.3 ng/mL total rhGDF15 is above the threshold of approximately 2 ng/mL hGDF15). To determine which form was the active form (i.e., either mFc-rhGDF15 or released mature rhGDF15), we considered the data from FIG. 8 which showed that approximately 90% of the total rhGDF15 in serum was in the mFc-rhGDF15 form, and the remaining 10% was the released mature form. Based on this extrapolation, approximately 3.0 ng/mL of rhGDF15 in the plasma was in the mFc-rhGDF15 form (i.e., 90% of 3.3 ng/mL). Once again, if mFc-rhGDF15 were active, these mice would be losing weight, not gaining weight because 3.3 ng/mL mFc-rhGDF15 is above the threshold of approximately 2 ng/mL hGDF15. The mice dosed with 0.1 μg/g mFc-rhGDF15 served as an internal control, because these mice had sustained body weight loss indicating that at least one of the two forms must be active. A calculation of 10% of 70 ng/mL total rhGDF15 in these mice is 7 ng/mL released mature rhGDF15. This amount is consistent with inducing the observed body weight loss and the threshold observed in FIG. 2 . Thus, the data indicate that the mFc-rhGDF15 is not an active form of the protein, and only the mature rhGDF15 is active. These results were unexpected, because: (a) there was no reason to predict that the Fc fusion protein (mFc-rhGDF15) would be inactive; and (b) there was no reason to predict that the Fc fusion protein would release mature rhGDF15 at the observed rate. These results indicate that mFc-rhGDF15 sustains a cachetic phenotype by slowly releasing mature rhGDF15 into the serum. These results further indicate that a steady state level of mature rhGDF15 in the plasma or serum can be achieved in a non-tumor bearing mouse by administering mFc-rhGDF15 to the mouse. Therefore, administration of mFc-rhGDF15 to non-tumor bearing mice is particularly useful as a mouse model of cachexia with a robust and sustained loss of muscle mass, loss of fat mass, and body weight loss (see FIGS. 6A-C ). Example 6 Anti-GDF15 Antibodies This Example describes the production of anti-GDF15 monoclonal antibodies. Immunizations, fusions, and primary screens were conducted using conventional methods following the Repetitive Immunization Multiple Sites (RIMMS) protocol. Five AJ mice and five Balb/c mice were immunized with 6×His (SEQ ID NO: 266) tagged recombinant human GDF15 (His-rhGDF15) (R&D Systems, Inc., Minneapolis, Minn.). Two Balb/c mice with sera displaying the highest anti-GDF15 activity by Enzyme Linked Immunosorbent Assay (ELISA) were chosen for subsequent fusion. Spleens and lymph nodes from the appropriate mice were harvested. B-cells were harvested and fused with a myeloma line. Fusion products were serially diluted onto forty 96-well plates to near clonality. Two AJ mice with sera displaying the highest anti-GDF15 activity by ELISA were chosen for subsequent fusion. Spleens and lymph nodes from the appropriate mice were harvested. B-cells were harvested and fused with a myeloma line. Fusion products were serially diluted onto forty 96-well plates to near clonality. Approximately 3,840 supernatants from the cell fusions were screened by ELISA for binding to rhGDF15. A total of 172 supernatants containing antibodies against GDF15 were further characterized in vitro. A panel of hybridomas was selected, subcloned and expanded. Antibodies were expressed and subsequently purified by affinity chromatography on Protein G resin, under standard conditions. Example 7 Antibody Sequence Analysis The light chain isotype and heavy chain isotype of each monoclonal antibody in Example 6 was determined using the IsoStrip™ Mouse Monoclonal Antibody Isotyping Kit according the kit vendor's instructions (Roche Applied Science, Indianapolis, Ind.). All antibodies were found to be kappa light chain, and IgG1 or IgG2b heavy chain. The heavy and light chain variable regions of the mouse monoclonal antibodies were sequenced using 5′ RACE (Rapid Amplification of cDNA Ends). Total RNA was extracted from each monoclonal hybridoma cell line using the RNeasy® Miniprep kit according to the kit vendor's instructions (Qiagen, Valencia, Calif.). Full-length first strand cDNA containing 5′ ends was generated using the SMARTer™ RACE cDNA Amplification Kit (Clontech, Mountain View, Calif.) according to the kit vendor's instructions for 5′ RACE. The variable regions of the light (kappa) and heavy (IgG1 or IgG2b) chains were amplified by PCR using KOD Hot Start Polymerase (EMD Chemicals, Gibbstown, N.J.) according to the kit vendor's instructions. For amplification of 5′ cDNA ends in conjunction with the SMARTer™ RACE cDNA Amplification Kit, the Universal Primer Mix A primer (Clontech), a mix of: 5′ CTAATACGACTCACTATAGGGCAAGCAGTGGTATCAACGCAGAGT 3′ (SEQ ID NO:233) and 5′ CTAATACGACTCACTATAGGGC 3′ (SEQ ID NO:225), was used as a 5′ primer. Heavy chain variable regions were amplified using the above 5′ primers and a 3′ IgG1 constant region specific primer, 5′ TATGCAAGGCTTACAACCACA 3′ (SEQ ID NO:226), or a 3′ IgG2b constant region specific primer, 5′ AGGACAGGGGTTGATTGTTGA 3′ (SEQ ID NO:227). Kappa chain variable regions were first amplified with the above 5′ primers and a 3′ kappa constant region specific primer, 5′ CTCATTCCTGTTGAAGCTCTTGACAAT 3′ (SEQ ID NO:228). The light chains were subjected to a second, nested, round of PCR using the Nested Universal Primer A (Clontech) 5′ primer, 5′ AAGCAGTGGTATCAACGCAGAGT 3′ (SEQ ID NO:229) and a nested 3′ kappa constant region specific primer, 5′ CGACTGAGGCACCTCCAGATGTT 3′ (SEQ ID NO:230). Individual PCR products were either purified using the Qiaquick® PCR Purification kit or isolated by agarose gel electrophoresis and purified using the Qiaquick® Gel Purification kit according to the kit vendor's instructions (Qiagen). The PCR products were subsequently cloned into the pCR®4Blunt plasmid using the Zero Blunt® TOPO® PCR Cloning according to the kit vendor's instructions (Invitrogen) and transformed into DH5-α bacteria (Invitrogen) through standard molecular biology techniques. Plasmid DNA isolated from transformed bacterial clones was sequenced using M13 Forward (5′ GTAAAACGACGGCCAGT 3′) (SEQ ID NO:231) and M13 Reverse primers (5′ CAGGAAACAGCTATGACC 3′) (SEQ ID NO:232) by Beckman Genomics (Danvers, Mass.), using standard dideoxy DNA sequencing methods to identify the sequence of the variable region sequences. The sequences were analyzed using Vector NTI software (Invitrogen) and the IMGT/V-Quest web server (imgt.cines.fr) to identify and confirm variable region sequences. The nucleic acid sequences encoding and the protein sequences defining variable regions of the murine monoclonal antibodies are shown below (amino terminal signal peptide sequences are not shown). CDR sequences (Kabat definition) are indicated by bold font and underlining in the amino acid sequences. Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 01G06 Antibody (SEQ ID NO:39) 1gaggtcctgc tgcaacagtc tggacctgag ctggtgaagcctggggcttc agtgaagata61ccctgcaagg cttctggata cacattcact gactacaacatggactgggt gaagcagagc121catggaaaga gccttgagtg gattggacaa attaatcctaacaatggtgg tattttcttc181aaccagaagt tcaagggcaa ggccacattg actgtagacaagtcctccaa tacagccttc241atggaggtcc gcagcctgac atctgaggac actgcagtctattactgtgc aagagaggca301attactacgg taggcgctat ggactactgg ggtcaaggaacctcagtcac cgtctcctca Protein Sequence Defining the Heavy Chain Variable Region of the 01G06 Antibody (SEQ ID NO:40) 1evllqqsgpe lvkpgasvki pckasgytft dynmd wvkqshgkslewig q inpnnggiff61nqkfkg katl tvdkssntaf mevrsltsed tavyycar eaittvgamdy w gqgtsvtvss Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 01G06 Antibody (SEQ ID NO:75) 1gacatccaga tgactcagtc tccagcctcc ctatctgcatctgtgggaga aactgtcacc61atcacatgtc gaacaagtga gaatcttcac aattatttagcatggtatca gcagaaacag121ggaaaatctc ctcagctcct ggtctatgat gcaaaaaccttagcagatgg tgtgccatca181aggttcagtg gcagtggatc aggaacacaa tattctctcaagatcaacag cctgcagcct241gaagattttg ggagttatta ctgtcaacat ttttggagtagtccttacac gttcggaggg301gggaccaagc tggaaataaa a Protein Sequence Defining the Kappa Chain Variable Region of the 01G06 Antibody (SEQ ID NO:76) 1diqmtqspas lsasvgetvt itc rtsenlh nyla wyqqkqgkspqllvy d aktlad gvps61rfsgsgsgtq yslkinslqp edfgsyyc qh fwsspyt fgggtkleik Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 03G05 Antibody (SEQ ID NO:41) 1caggtccaac tgcagcagcc tggggctgaa ctggtgaagcctggggcttc agtgaagctg61tcctgcaagg cttctggcta caccttcacc agctactggattcactgggt gaaccagagg121cctggacaag gccttgagtg gattggagac attaatcctagcaacggccg tagtaagtat181aatgagaagt tcaagaacaa ggccacaatg actgcagacaaatcctccaa cacagcctac241atgcaactca gcagcctgac atctgaggac tctgcggtctattactgtgc aagagaggtt301ctggatggtg ctatggacta ctggggtcaa ggaacctcagtcaccgtctc ctca Protein Sequence Defining the Heavy Chain Variable Region of the 03G05 Antibody (SEQ ID NO:42) 1qvqlqqpgae lvkpgasvkl sckasgytft sywih wvnqrpgqglewig d inpsngrsky61nekfkn katm tadkssntay mqlssltsed savyycar evldgamdy wgq gtsvtvss Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 03G05 Antibody (SEQ ID NO:77) 1gacattgtgt tgacccaatc tccagcttct ttggctgtgtctctagggca gagggccacc61atctcctgca gagccagcga aagtgttgat aattatggcattagttttat gaactggttc121caacagaaac caggacagcc acccaaactc ctcatctatgctgcatccaa ccaaggctcc181ggggtccctg ccaggtttag tggcagtggg tctgggacagacttcagcct caacatccat241cctatggagg aggatgatac tgcaatgtat ttctgtcagcaaagtaagga ggttccgtgg301acgttcggtg gaggctccaa gctggaaatc aaa Protein Sequence Defining the Kappa Chain Variable Region of the 03G05 Antibody (SEQ ID NO:78) 1divltqspas lavslgqrat isc rasesvd nygisfmn wfqqkpgqppkl liy aasnqgs61gvparfsgsg sgtdfslnih pmeeddtamyfc qqskevpw t fgggsklei k Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 04F08 Antibody (SEQ ID NO:43) 1caggttactc tgaaagagtc tggccctggg atattgcagccctcccagac cctcagtctg61acttgttctt tctctgggtt ttcactgagc acttatggtatgggtgtgac ctggattcgt121cagccttcag gaaagggtct ggagtggctg gcacacatttactgggatga tgacaagcgc181tataacccat ccctgaagag ccggctcaca atctccaaggatacctccaa caaccaggta241ttcctcaaga tcaccagtgt ggacactgca gatactgccacatactactg tgctcaaacg301gggtatagta acttgtttgc ttactggggc caagggactctggtcactgt ctctgca Protein Sequence Defining the Heavy Chain Variable Region of the 04F08 Antibody (SEQ ID NO:44) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsls tygmgvt wirqpsgkglewl a hiywdddkr61ynpslks rlt iskdtsnnqv flkitsvdta dtatyycaq tgysnlfay wg qgtlvtvsa Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 04F08 Antibody (SEQ ID NO:79) 1gacattgtga tgacccagtc tcaaaaattc atgtccacatcagtaggaga cagggtcagc61gtcacctgca aggccagtca gaatgtgggt actaatgtagcctggtatca acagaaatta121ggacaatctc ctaaaacact gatttactcg gcatcctaccggtacagtgg agtccctgat181cgcttcacag gcagtggatc tgggacagat ttcactctcaccatcagcaa tgtgcagtct241gaagacttgg cagagtattt ctgtcagcaa tataacagctatccgtacac gttcggaggg301gggaccaagc tggaaataaa a Protein Sequence Defining the Kappa Chain Variable Region of the 04F08 Antibody (SEQ ID NO:80) 1divmtqsqkf mstsvgdrvs vtc kasqnvg tnva wyqqklgqspktliy s asyrys gvpd61rftgsgsgtd ftltisnvqs edlaeyfc qq ynsypyt fgggtkleik Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 06C11 Antibody (SEQ ID NO:45) 1caggttactc tgaaagagtc tggccctggg atattgcagccctcccagac cctcagtctg61acttgttctt tctctgggtt ttcactgaac acttatggtatgggtgtgag ctggattcgt121cagccttcag gaaagggtct ggagtggctg gcacacatttactgggatga tgacaagcgc181tataacccat ccctgaagag ccggctcaca atctccaaggatgcctccaa caaccgggtc241ttcctcaaga tcaccagtgt ggacactgca gatactgccacatactactg tgctcaaaga301ggttatgatg attactgggg ttactggggc caagggactctggtcactat ctctgca Protein Sequence Defining the Heavy Chain Variable Region of the 06C11 Antibody (SEQ ID NO:46) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsln tygmgvs wirqpsgkglewl a hiywdddkr61ynpslks rlt iskdasnnrv flkitsvdta dtatyycaq rgyddywgy wg qgtlvtisa Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 06C11 Antibody (SEQ ID NO:81) 1gacattgtga tgacccagtc tcaaaaattc atgtccacatcagtaggaga cagggtcagc61gtcacctgca aggccagtca gaatgtgggt actaatgtagcctggtttca acagaaacca121ggtcaatctc ctaaagcact gatttactcg gcatcttaccggtacagtgg agtccctgat181cgcttcacag gcagtggatc tgggacagat ttcattctcaccatcagcaa tgtgcagtct241gaagacctgg cagagtattt ctgtcagcaa tataacaactatcctctcac gttcggtgct301gggaccaagc tggagctgaa a Protein Sequence Defining the Kappa Chain Variable Region of the 06C11 Antibody (SEQ ID NO:82) 1divmtqsqkf mstsvgdrvs vtc kasqnvg tnva wfqqkpgqspkaliy s asyrys gvpd61rftgsgsgtd filtisnvqs edlaeyfc qq ynnyplt fgagtklelk Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 08G01 Antibody (SEQ ID NO:47) 1gaggtcctgc tgcaacagtc tggacctgag gtggtgaagcctggggcttc agtgaagata61ccctgcaagg cttctggata cacattcact gactacaacatggactgggt gaagcagagc121catggaaaga gccttgagtg gattggagag attaatcctaacaatggtgg tactttctac181aaccagaagt tcaagggcaa ggccacattg actgtagacaagtcctccag cacagcctac241atggagctcc gcagcctgac atctgaggac actgcagtctattactgtgc aagagaggca301attactacgg taggcgctat ggactactgg ggtcaaggaacctcagtcac cgtctcctca Protein Sequence Defining the Heavy Chain Variable Region of the 08G01 Antibody (SEQ ID NO:48) 1evllqqsgpe vvkpgasvki pckasgytft dynmd wvkqshgkslewig e inpnnggtfy61nqkfkg katl tvdkssstay melrsltsed tavyycar eaittvgamdy w gqgtsvtvss Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 08G01 Antibody (SEQ ID NO:83) 1gacatccaga tgactcagtc tccagcctcc ctatctgcatctgtgggaga aactgtcacc61atcacatgtc gagcaagtgg gaatattcac aattatttagcatggtatca gcagaaacag121ggaaaatctc ctcagctcct ggtctataat gcaaaaaccttagcagatgg tgtgccatca181aggttcagtg gcagtggatc aggaacacaa tattctctcaagatcaacag cctgcagcct241gaagattttg ggagttatta ctgtcaacat ttttggagttctccttacac gttcggaggg301gggaccaagc tggaaataaa a Protein Sequence Defining the Kappa Chain Variable Region of the 08G01 Antibody (SEQ ID NO:84) 1diqmtqspas lsasvgetvt itc rasgnih nyla wyqqkqgkspqllvy n aktlad gvps61rfsgsgsgtq yslkinslqp edfgsyyc qh fwsspyt fgggtkleik Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 14F11 Antibody (SEQ ID NO:49) 1caggttactc tgaaagagtc tggccctgga atattgcagccctcccagac cctcagtctg61acttgttctt tctctgggtt ttcactgagc acttatggtatgggtgtagg ctggattcgt121cagccttcag gaaagggtct agagtggctg gcagacatttggtgggatga cgataagtac181tataacccat ccctgaagag ccggctcaca atctccaaggatacctccag caatgaggta241ttcctcaaga tcgccattgt ggacactgca gatactgccacttactactg tgctcgaaga301ggtcactact ctgctatgga ctactggggt caaggaacctcagtcaccgt ctcctca Protein Sequence Defining the Heavy Chain Variable Region of the 14F11 Antibody (SEQ ID NO:50) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsls tygmgvg wirqpsgkglewl a diwwdddky61ynpslks rlt iskdtssnev flkiaivdta dtatyycar rghysamdy wg qgtsvtvss Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 14F11 Antibody (SEQ ID NO:85) 1gacattgtaa tgacccagtc tcaaaaattc atgtccacatcagtaggaga cagggtcagc61gtcacctgca aggccagtca gaatgtgggt actaatgtagcctggtatca acagaaacca121gggcaatctc ctaaagcact gatttactcg ccatcctaccggtacagtgg agtccctgat181cgcttcacag gcagtggatc tgggacagat ttcactctcaccatcagcaa tgtgcagtct241gaagacttgg cagaatattt ctgtcagcaa tataacagctatcctcacac gttcggaggg301gggaccaagc tggaaatgaa a Protein Sequence Defining the Kappa Chain Variable Region of the 14F11 Antibody (SEQ ID NO:86) 1divmtqsqkf mstsvgdrvs vtc kasqnvg tnva wyqqkpgqspkaliy s psyrys gvpd61rftgsgsgtd ftltisnvqs edlaeyfc qq ynsypht fgggtklemk Nucleic Acid Sequence Encoding the Heavy Chain Variable Region of the 17B11 Antibody (SEQ ID NO:51) 1caggttactc tgaaagagtc tggccctggg atattgcagccctcccagac cctcagtctg61acttgttctt tctctgggtt ttcactgagc acttctggtatgggtgtgag ttggattcgt121cagccttcag gaaagggtct ggagtggctg gcacacaatgactgggatga tgacaagcgc181tataagtcat ccctgaagag ccggctcaca atatccaaggatacctccag aaaccaggta241ttcctcaaga tcaccagtgt ggacactgca gatactgccacatactactg tgctcgaaga301gttgggggat tagagggcta ttttgattac tggggccaaggcaccactct cacagtctcc361tca Protein Sequence Defining the Heavy Chain Variable Region of the 17B11 Antibody (SEQ ID NO:52) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsls tsgmgvs wirqpsgkglewl a hndwdddkr61yksslks rlt iskdtsrnqv flkitsvdta dtatyycar rvgglegyfdy wgqgttltvs121s Nucleic Acid Sequence Encoding the Kappa Chain Variable Region of the 17B11 Antibody (SEQ ID NO:87) 1gacattgtgc tgacacagtc tcctgcttcc ttagctgtatctctggggca gagggccacc61atctcatgca gggccagcca aagtgtcagt acatctaggtttagttatat gcactggttc121caacagaaac caggacaggc acccaaactc ctcatcaagtatgcatccaa cctagaatct181ggggtccctg ccaggttcag tggcagtggg tctgggacagacttcaccct caacatccat241cctgtggagg gggaggatac tgcaacatat tactgtcagcacagttggga gattccgtac301acgttcggag gggggaccaa gctggaaata aaa Protein Sequence Defining the Kappa Chain Variable Region of the 17B11 Antibody (SEQ ID NO:88) 1divltqspas lavslgqrat isc rasqsvs tsrfsymh wfqqkpgqapkl lik yasnles61gvparfsgsg sgtdftlnih pvegedtaty yc qhsweipyt fgggtklei k The amino acid sequences defining the immunoglobulin heavy chain variable regions for the antibodies produced in Example 6 are aligned in FIG. 10 . Amino terminal signal peptide sequences (for expression/secretion) are not shown. CDR 1 , CDR 2 , and CDR 3 (Kabat definition) are identified by boxes. FIG. 11 shows an alignment of the separate CDR 1 , CDR 2 , and CDR 3 sequences for each antibody. The amino acid sequences defining the immunoglobulin light chain variable regions of the antibodies in Example 6 are aligned in FIG. 12 . Amino terminal signal peptide sequences (for expression/secretion) are not shown. CDR 1 , CDR 2 and CDR 3 are identified by boxes. FIG. 13 shows an alignment of the separate CDR 1 , CDR 2 , and CDR 3 sequences for each antibody. Table 2 shows the SEQ ID NO. of each sequence discussed in this Example. TABLE 2SEQ. ID NO.Nucleic Acid or Protein3901G06 Heavy Chain Variable Region-nucleic acid4001G06 Heavy Chain Variable Region-protein7501G06 Light (kappa) Chain Variable Region-nucleic acid7601G06 Light (kappa) Chain Variable Region-protein101G06 Heavy Chain CDR 1701G06 Heavy Chain CDR 21501G06 Heavy Chain CDR 32101G06 Light (kappa) Chain CDR 12601G06 Light (kappa) Chain CDR 23201G06 Light (kappa) Chain CDR 34103G05 Heavy Chain Variable Region-nucleic acid4203G05 Heavy Chain Variable Region-protein7703G05 Light (kappa) Chain Variable Region-nucleic acid7803G05 Light (kappa) Chain Variable Region-protein203G05 Heavy Chain CDR 1803G05 Heavy Chain CDR 21603G05 Heavy Chain CDR 32203G05 Light (kappa) Chain CDR 12703G05 Light (kappa) Chain CDR 23303G05 Light (kappa) Chain CDR 34304F08 Heavy Chain Variable Region-nucleic acid4404F08 Heavy Chain Variable Region-protein7904F08 Light (kappa) Chain Variable Region-nucleic acid8004F08 Light (kappa) Chain Variable Region-protein304F08 Heavy Chain CDR 1904F08 Heavy Chain CDR 21704F08 Heavy Chain CDR 32304F08 Light (kappa) Chain CDR 12804F08 Light (kappa) Chain CDR 23404F08 Light (kappa) Chain CDR 34506C11 Heavy Chain Variable Region-nucleic acid4606C11 Heavy Chain Variable Region-protein8106C11 Light (kappa) Chain Variable Region-nucleic acid8206C11 Light (kappa) Chain Variable Region-protein406C11 Heavy Chain CDR 1906C11 Heavy Chain CDR 21806C11 Heavy Chain CDR 32306C11 Light (kappa) Chain CDR 12806C11 Light (kappa) Chain CDR 23506C11 Light (kappa) Chain CDR 34708G01 Heavy Chain Variable Region-nucleic acid4808G01 Heavy Chain Variable Region-protein8308G01 Light (kappa) Chain Variable Region-nucleic acid8408G01 Light (kappa) Chain Variable Region-protein108G01 Heavy Chain CDR 11008G01 Heavy Chain CDR 21508G01 Heavy Chain CDR 32408G01 Light (kappa) Chain CDR 12908G01 Light (kappa) Chain CDR 23208G01 Light (kappa) Chain CDR 34914F11 Heavy Chain Variable Region-nucleic acid5014F11 Heavy Chain Variable Region-protein8514F11 Light (kappa) Chain Variable Region-nucleic acid8614F11 Light (kappa) Chain Variable Region-protein514F11 Heavy Chain CDR 11114F11 Heavy Chain CDR 21914F11 Heavy Chain CDR 32314F11 Light (kappa) Chain CDR 13014F11 Light (kappa) Chain CDR 23614F11 Light (kappa) Chain CDR 35117B11 Heavy Chain Variable Region-nucleic acid5217B11 Heavy Chain Variable Region-protein8717B11 Light (kappa) Chain Variable Region-nucleic acid8817B11 Light (kappa) Chain Variable Region-protein617B11 Heavy Chain CDR 11217B11 Heavy Chain CDR 22017B11 Heavy Chain CDR 32517B11 Light (kappa) Chain CDR 13117B11 Light (kappa) Chain CDR 23717B11 Light (kappa) Chain CDR 3 Mouse monoclonal antibody heavy chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 3. TABLE 3Variable RegionCDR1CDR2CDR3SEQ ID NOKabat01G06DYNMDQINPNNGGIFFNQKFKGEAITTVGAMDY40(SEQ ID NO: 1)(SEQ ID NO: 7)(SEQ ID NO: 15)03G05SYWIHDINPSNGRSKYNEKFKNEVLDGAMDY42(SEQ ID NO: 2)(SEQ ID NO: 8)(SEQ ID NO: 16)04F08TYGMGVTHIYWDDDKRYNPSLKSTGYSNLFAY44(SEQ ID NO: 3)(SEQ ID NO: 9)(SEQ ID NO: 17)06C11TYGMGVSHIYWDDDKRYNPSLKSRGYDDYWGY46(SEQ ID NO: 4)(SEQ ID NO: 9)(SEQ ID NO: 18)08G01DYNMDEINPNNGGTFYNQKFKGEAITTVGAMDY48(SEQ ID NO: 1)(SEQ ID NO: 10)(SEQ ID NO: 15)14F11TYGMGVGDIWWDDDKYYNPSLKSRGHYSAMDY50(SEQ ID NO: 5)(SEQ ID NO: 11)(SEQ ID NO: 19)17B11TSGMGVSHNDWDDDKRYKSSLKSRVGGLEGYFDY52(SEQ ID NO: 6)(SEQ ID NO: 12)(SEQ ID NO: 20)Chothia01G06GYTFTDYNPNNGGEAITTVGAMDY40(SEQ ID NO: 38)(SEQ ID NO: 143)(SEQ ID NO: 15)03G05GYTFTSYNPSNGREVLDGAMDY42(SEQ ID NO: 128)(SEQ ID NO: 144)(SEQ ID NO: 16)04F08GFSLSTYGMYWDDDTGYSNLFAY44(SEQ ID NO: 130)(SEQ ID NO: 145)(SEQ ID NO: 17)06C11GFSLNTYGMYWDDDRGYDDYWGY46(SEQ ID NO: 132)(SEQ ID NO: 145)(SEQ ID NO: 18)08G01GYTFTDYNPNNGGEAITTVGAMDY48(SEQ ID NO: 38)(SEQ ID NO: 143)(SEQ ID NO: 15)14F11GFSLSTYGMWWDDDRGHYSAMDY50(SEQ ID NO: 130)(SEQ ID NO: 146)(SEQ ID NO: 19)17B11GFSLSTSGMDWDDDRVGGLEGYFDY52(SEQ ID NO: 134)(SEQ ID NO: 147)(SEQ ID NO: 20)IMGT01G06GYTFTDYNINPNNGGIAREAITTVGAMDY40(SEQ ID NO: 136)(SEQ ID NO: 148)(SEQ ID NO: 154)03G05GYTFTSYWINPSNGRSAREVLDGAMDY42(SEQ ID NO: 138)(SEQ ID NO: 149)(SEQ ID NO: 155)04F08GFSLSTYGMGIYWDDDKAQTGYSNLFAY44(SEQ ID NO: 140)(SEQ ID NO: 150)(SEQ ID NO: 156)06C11GFSLNTYGMGIYWDDDKAQRGYDDYWGY46(SEQ ID NO: 141)(SEQ ID NO: 150)(SEQ ID NO: 157)08G01GYTFTDYNINPNNGGTAREAITTVGAMDY48(SEQ ID NO: 136)(SEQ ID NO: 151)(SEQ ID NO: 154)14F11GFSLSTYGMGIWWDDDKARRGHYSAMDY50(SEQ ID NO: 140)(SEQ ID NO: 152)(SEQ ID NO: 158)17B11GFSLSTSGMGNDWDDDKARRVGGLEGYFDY52(SEQ ID NO: 142)(SEQ ID NO: 153)(SEQ ID NO: 159) Mouse monoclonal antibody Kappa light chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 4. TABLE 4Variable RegionCDR1CDR2CDR3SEQ ID NOKabat/Chothia01G06RTSENLHNYLADAKTLADQHFWSSPYT76(SEQ ID NO: 21)(SEQ ID NO: 26)(SEQ ID NO: 32)03G05RASESVDNYGISFMNAASNQGSQQSKEVPWT78(SEQ ID NO: 22)(SEQ ID NO: 27)(SEQ ID NO: 33)04F08KASQNVGTNVASASYRYSQQYNSYPYT80(SEQ ID NO: 23)(SEQ ID NO: 28)(SEQ ID NO: 34)06C11KASQNVGTNVASASYRYSQQYNNYPLT82(SEQ ID NO: 23)(SEQ ID NO: 28)(SEQ ID NO: 35)08G01RASGNIHNYLANAKTLADQHFWSSPYT84(SEQ ID NO: 24)(SEQ ID NO: 29)(SEQ ID NO: 32)14F11KASQNVGTNVASPSYRYSQQYNSYPHT86(SEQ ID NO: 23)(SEQ ID NO: 30)(SEQ ID NO: 36)17B11RASQSVSTSRFSYMHYASNLESQHSWEIPYT88(SEQ ID NO: 25)(SEQ ID NO: 31)(SEQ ID NO: 37)IMGT01G06ENLHNYDAKQHFWSSPYT76(SEQ ID NO: 160)(SEQ ID NO: 32)03G05ESVDNYGISFAASQQSKEVPWT78(SEQ ID NO: 161)(SEQ ID NO: 33)04F08QNVGTNSASQQYNSYPYT80(SEQ ID NO: 162)(SEQ ID NO: 34)06C11QNVGTNSASQQYNNYPLT82(SEQ ID NO: 162)(SEQ ID NO: 35)08G01GNIHNYNAKQHFWSSPYT84(SEQ ID NO: 163)(SEQ ID NO: 32)14F11QNVGTNSPSQQYNSYPHT86(SEQ ID NO: 162)(SEQ ID NO: 36)17B11QSVSTSRFSYYASQHSWEIPYT88(SEQ ID NO: 164)(SEQ ID NO: 37) To create the complete heavy or kappa chain antibody sequences, each variable sequence above is combined with its respective constant region. For example, a complete heavy chain comprises a heavy variable sequence followed by the murine IgG1 or IgG2b heavy chain constant sequence, and a complete kappa chain comprises a kappa variable sequence followed by the murine kappa light chain constant sequence. Nucleic Acid Sequence Encoding the Murine IgG1 Heavy Chain Constant Region (SEQ ID NO:165) 1gccaaaacga cacccccatc tgtctatcca ctggcccctggatctgctgc ccaaactaac61tccatggtga ccctgggatg cctggtcaag ggctatttccctgagccagt gacagtgacc121tggaactctg gatccctgtc cagcggtgtg cacaccttcccagctgtcct gcagtctgac181ctctacactc tgagcagctc agtgactgtc ccctccagcacctggcccag cgagaccgtc241acctgcaacg ttgcccaccc ggccagcagc accaaggtggacaagaaaat tgtgcccagg301gattgtggtt gtaagccttg catatgtaca gtcccagaagtatcatctgt cttcatcttc361cccccaaagc ccaaggatgt gctcaccatt actctgactcctaaggtcac gtgtgttgtg421gtagacatca gcaaggatga tcccgaggtc cagttcagctggtttgtaga tgatgtggag481gtgcacacag ctcagacgca accccgggag gagcagttcaacagcacttt ccgctcagtc541agtgaacttc ccatcatgca ccaggactgg ctcaatggcaaggagttcaa atgcagggtc601aacagtgcag ctttccctgc ccccatcgag aaaaccatctccaaaaccaa aggcagaccg661aaggctccac aggtgtacac cattccacct cccaaggagcagatggccaa ggataaagtc721agtctgacct gcatgataac agacttcttc cctgaagacattactgtgga gtggcagtgg781aatgggcagc cagcggagaa ctacaagaac actcagcccatcatggacac agatggctct841tacttcgtct acagcaagct caatgtgcag aagagcaactgggaggcagg aaatactttc901acctgctctg tgttacatga gggcctgcac aaccaccatactgagaagag cctctcccac961tctcctggta aa Protein Sequence Defining the Murine IgG1 Heavy Chain Constant Region (SEQ ID NO:166) 1akttppsvyp lapgsaaqtn smvtlgclvk gyfpepvtvtwnsgslssgv htfpavlqsd61lytlsssvtv psstwpsetv tcnvahpass tkvdkkivprdcgckpcict vpevssvfif121ppkpkdvlti tltpkvtcvv vdiskddpev qfswfvddvevhtaqtqpre eqfnstfrsv181selpimhqdw lngkefkcru nsaafpapie ktisktkgrpkapqvytipp pkeqmakdkv241sltcmitdff peditvewqw ngqpaenykn tqpimdtdgsyfvysklnvq ksnweagntf301tcsvlheglh nhhtekslsh spgk Nucleic Acid Sequence Encoding the Murine IgG2b Heavy Chain Constant Region (SEQ ID NO:167) 1gccaaaacaa cacccccatc agtctatcca ctggcccctgggtgtggaga tacaactggt61tcctccgtga ctctgggatg cctggtcaag ggctacttccctgagtcagt gactgtgact121tggaactctg gatccctgtc cagcagtgtg cacaccttcccagctctcct gcagtctgga181ctctacacta tgagcagctc agtgactgtc ccctccagcacctggccaag tcagaccgtc241acctgcagcg ttgctcaccc agccagcagc accacggtggacaaaaaact tgagcccagc301gggcccattt caacaatcaa cccctgtcct ccatgcaaggagtgtcacaa atgcccagct361cctaacctcg agggtggacc atccgtcttc atcttccctccaaatatcaa ggatgtactc421atgatctccc tgacacccaa ggtcacgtgt gtggtggtggatgtgagcga ggatgaccca481gacgtccaga tcagctggtt tgtgaacaac gtggaagtacacacagctca gacacaaacc541catagagagg attacaacag tactatccgg gtggtcagcaccctccccat ccagcaccag601gactggatga gtggcaagga gttcaaatgc aaggtcaacaacaaagacct cccatcaccc661atcgagagaa ccatctcaaa aattaaaggg ctagtcagagctccacaagt atacatcttg721ccgccaccag cagagcagtt gtccaggaaa gatgtcagtctcacttgcct ggtcgtgggc781ttcaaccctg gagacatcag tgtggagtgg accagcaatgggcatacaga ggagaactac841aaggacaccg caccagtcct agactctgac ggttcttacttcatatatag caagctcaat901atgaaaacaa gcaagtggga gaaaacagat tccttctcatgcaacgtgag acacgagggt961ctgaaaaatt actacctgaa gaagaccatc tcccggtctccgggtaaa Protein Sequence Defining the Murine IgG2b Heavy Chain Constant Region (SEQ ID NO:168) 1akttppsvyp lapgcgdttg ssvtlgclvk gyfpesvtvtwnsgslsssv htfpallqsg61lytmsssvtv psstwpsqtv tcsvahpass ttvdkklepsgpistinpcp pckechkcpa121pnleggpsvf ifppnikdvl misltpkvtc vvvdvseddpdvqiswfvnn vevhtaqtqt181hredynstir vvstlpiqhq dwmsgkefkc kvnnkdlpspiertiskikg lvrapqvyil241pppaeqlsrk dvsltclvvg fnpgdisvew tsnghteenykdtapvldsd gsyfiyskln301mktskwektd sfscnvrheg lknyylkkti srspgk Nucleic Acid Sequence Encoding the Murine Kappa Light Chain Constant Region (SEQ ID NO:169) 1cgggctgatg ctgcaccaac tgtatccatc ttcccaccatccagtgagca gttaacatct61ggaggtgcct cagtcgtgtg cttcttgaac aacttctaccccaaagacat caatgtcaag121tggaagattg atggcagtga acgacaaaat ggcgtcctgaacagttggac tgatcaggac181agcaaagaca gcacctacag catgagcagc accctcacgttgaccaagga cgagtatgaa241cgacataaca gctatacctg tgaggccact cacaagacatcaacttcacc cattgtcaag301agcttcaaca ggaatgagtg t Protein Sequence Defining the Murine Kappa Light Chain Constant Region (SEQ ID NO:170) 1radaaptvsi fppsseqlts ggasvvcfln nfypkdinvkwkidgserqn gvlnswtdqd61skdstysmss tltltkdeye rhnsytceat hktstspivksfnrnec The following sequences represent the actual or contemplated full length heavy and light chain sequence (i.e., containing both the variable and constant regions sequences) for each antibody described in this Example. Signal sequences for proper secretion of the antibodies (e.g., signal sequences at the 5′ end of the DNA sequences or the amino terminal end of the protein sequences) are not shown in the full length heavy and light chain sequences disclosed herein and are not included in the final secreted protein. Also not shown are stop codons for termination of translation required at the 3′ end of the DNA sequences. It is within ordinary skill in the art to select a signal sequence and/or a stop codon for expression of the disclosed full length immunoglobulin heavy chain and light chain sequences. It is also contemplated that the variable region sequences can be ligated to other constant region sequences to produce active full length immunoglobulin heavy and light chains. Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 01G06 (SEQ ID NO:99) 1gaggtcctgc tgcaacagtc tggacctgag ctggtgaagcctggggcttc agtgaagata61ccctgcaagg cttctggata cacattcact gactacaacatggactgggt gaagcagagc121catggaaaga gccttgagtg gattggacaa attaatcctaacaatggtgg tattttcttc181aaccagaagt tcaagggcaa ggccacattg actgtagacaagtcctccaa tacagccttc241atggaggtcc gcagcctgac atctgaggac actgcagtctattactgtgc aagagaggca301attactacgg taggcgctat ggactactgg ggtcaaggaacctcagtcac cgtctcctca361gccaaaacga cacccccatc tgtctatcca ctggcccctggatctgctgc ccaaactaac421tccatggtga ccctgggatg cctggtcaag ggctatttccctgagccagt gacagtgacc481tggaactctg gatccctgtc cagcggtgtg cacaccttcccagctgtcct gcagtctgac541ctctacactc tgagcagctc agtgactgtc ccctccagcacctggcccag cgagaccgtc601acctgcaacg ttgcccaccc ggccagcagc accaaggtggacaagaaaat tgtgcccagg661gattgtggtt gtaagccttg catatgtaca gtcccagaagtatcatctgt cttcatcttc721cccccaaagc ccaaggatgt gctcaccatt actctgactcctaaggtcac gtgtgttgtg781gtagacatca gcaaggatga tcccgaggtc cagttcagctggtttgtaga tgatgtggag841gtgcacacag ctcagacgca accccgggag gagcagttcaacagcacttt ccgctcagtc901agtgaacttc ccatcatgca ccaggactgg ctcaatggcaaggagttcaa atgcagggtc961aacagtgcag ctttccctgc ccccatcgag aaaaccatctccaaaaccaa aggcagaccg1021aaggctccac aggtgtacac cattccacct cccaaggagcagatggccaa ggataaagtc1081agtctgacct gcatgataac agacttcttc cctgaagacattactgtgga gtggcagtgg1141aatgggcagc cagcggagaa ctacaagaac actcagcccatcatggacac agatggctct1201tacttcgtct acagcaagct caatgtgcag aagagcaactgggaggcagg aaatactttc1261acctgctctg tgttacatga gggcctgcac aaccaccatactgagaagag cctctcccac1321tctcctggta aa Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 01G06 (SEQ ID NO:100) 1evllqqsgpe lvkpgasvki pckasgytft dynmdwvkqshgkslewigq inpnnggiff61nqkfkgkatl tvdkssntaf mevrsltsed tavyycareaittvgamdyw gqgtsvtvss121akttppsvyp lapgsaaqtn smvtlgclvk gyfpepvtvtwnsgslssgv htfpavlqsd181lytlsssvtv psstwpsetv tcnvahpass tkvdkkivprdcgckpcict vpevssvfif241ppkpkdvlti tltpkvtcvv vdiskddpev qfswfvddvevhtaqtqpre eqfnstfrsv301selpimhqdw lngkefkcrv nsaafpapie ktisktkgrpkapqvytipp pkeqmakdkv361sltcmitdff peditvewqw ngqpaenykn tqpimdtdgsyfvysklnvq ksnweagntf421tcsvlheglh nhhtekslsh spgk Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 01G06 (SEQ ID NO:101) 1gacatccaga tgactcagtc tccagcctcc ctatctgcatctgtgggaga aactgtcacc61atcacatgtc gaacaagtga gaatcttcac aattatttagcatggtatca gcagaaacag121ggaaaatctc ctcagctcct ggtctatgat gcaaaaaccttagcagatgg tgtgccatca181aggttcagtg gcagtggatc aggaacacaa tattctctcaagatcaacag cctgcagcct241gaagattttg ggagttatta ctgtcaacat ttttggagtagtccttacac gttcggaggg301gggaccaagc tggaaataaa acgggctgat gctgcaccaactgtatccat cttcccacca361tccagtgagc agttaacatc tggaggtgcc tcagtcgtgtgcttcttgaa caacttctac421cccaaagaca tcaatgtcaa gtggaagatt gatggcagtgaacgacaaaa tggcgtcctg481aacagttgga ctgatcagga cagcaaagac agcacctacagcatgagcag caccctcacg541ttgaccaagg acgagtatga acgacataac agctatacctgtgaggccac tcacaagaca601tcaacttcac ccattgtcaa gagcttcaac aggaatgagt gt Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 01G06 (SEQ ID NO:102) 1diqmtqspas lsasvgetvt itcrtsenlh nylawyqqkqgkspqllvyd aktladgvps61rfsgsgsgtq yslkinslqp edfgsyycqh fwsspytfgggtkleikrad aaptvsifpp121sseqltsgga svvcflnnfy pkdinvkwki dgserqngvlnswtdqdskd stysmsstlt181ltkdeyerhn sytceathkt stspivksfn rnec Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 03G05 (SEQ ID NO:103) 1caggtccaac tgcagcagcc tggggctgaa ctggtgaagcctggggcttc agtgaagctg61tcctgcaagg cttctggcta caccttcacc agctactggattcactgggt gaaccagagg121cctggacaag gccttgagtg gattggagac attaatcctagcaacggccg tagtaagtat181aatgagaagt tcaagaacaa ggccacaatg actgcagacaaatcctccaa cacagcctac241atgcaactca gcagcctgac atctgaggac tctgcggtctattactgtgc aagagaggtt301ctggatggtg ctatggacta ctggggtcaa ggaacctcagtcaccgtctc ctcagccaaa361acgacacccc catctgtcta tccactggcc cctggatctgctgcccaaac taactccatg421gtgaccctgg gatgcctggt caagggctat ttccctgagccagtgacagt gacctggaac481tctggatccc tgtccagcgg tgtgcacacc ttcccagctgtcctgcagtc tgacctctac541actctgagca gctcagtgac tgtcccctcc agcacctggcccagcgagac cgtcacctgc601aacgttgccc acccggccag cagcaccaag gtggacaagaaaattgtgcc cagggattgt661ggttgtaagc cttgcatatg tacagtccca gaagtatcatctgtcttcat cttcccccca721aagcccaagg atgtgctcac cattactctg actcctaaggtcacgtgtgt tgtggtagac781atcagcaagg atgatcccga ggtccagttc agctggtttgtagatgatgt ggaggtgcac841acagctcaga cgcaaccccg ggaggagcag ttcaacagcactttccgctc agtcagtgaa901cttcccatca tgcaccagga ctggctcaat ggcaaggagttcaaatgcag ggtcaacagt961gcagctttcc ctgcccccat cgagaaaacc atctccaaaaccaaaggcag accgaaggct1021ccacaggtgt acaccattcc acctcccaag gagcagatggccaaggataa agtcagtctg1081acctgcatga taacagactt cttccctgaa gacattactgtggagtggca gtggaatggg1141cagccagcgg agaactacaa gaacactcag cccatcatggacacagatgg ctcttacttc1201gtctacagca agctcaatgt gcagaagagc aactgggaggcaggaaatac tttcacctgc1261tctgtgttac atgagggcct gcacaaccac catactgagaagagcctctc ccactctcct1321ggtaaa Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 03G05 (SEQ ID NO:104) 1qvqlqqpgae lvkpgasvkl sckasgytft sywihwvnqrpgqglewigd inpsngrsky61nekfknkatm tadkssntay mqlssltsed savyycarevldgamdywgq gtsvtvssak121ttppsvypla pgsaaqtnsm vtlgclvkgy fpepvtvtwnsgslssgvht fpavlqsdly181tlsssvtvps stwpsetvtc nvahpasstk vdkkivprdcgckpcictvp evssvfifpp241kpkdvltitl tpkvtcvvvd iskddpevqf swfvddvevhtaqtqpreeq fnstfrsvse301lpimhqdwln gkefkcrvns aafpapiekt isktkgrpkapqvytipppk eqmakdkvsl361tcmitdffpe ditvewqwng qpaenykntq pimdtdgsyfvysklnvqks nweagntftc421svlheglhnh htekslshsp gk Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 03G05 (SEQ ID NO:105) 1gacattgtgt tgacccaatc tccagcttct ttggctgtgtctctagggca gagggccacc61atctcctgca gagccagcga aagtgttgat aattatggcattagttttat gaactggttc121caacagaaac caggacagcc acccaaactc ctcatctatgctgcatccaa ccaaggctcc181ggggtccctg ccaggtttag tggcagtggg tctgggacagacttcagcct caacatccat241cctatggagg aggatgatac tgcaatgtat ttctgtcagcaaagtaagga ggttccgtgg301acgttcggtg gaggctccaa gctggaaatc aaacgggctgatgctgcacc aactgtatcc361atcttcccac catccagtga gcagttaaca tctggaggtgcctcagtcgt gtgcttcttg421aacaacttct accccaaaga catcaatgtc aagtggaagattgatggcag tgaacgacaa481aatggcgtcc tgaacagttg gactgatcag gacagcaaagacagcaccta cagcatgagc541agcaccctca cgttgaccaa ggacgagtat gaacgacataacagctatac ctgtgaggcc601actcacaaga catcaacttc acccattgtc aagagcttcaacaggaatga gtgt Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 03G05 (SEQ ID NO:106) 1divltqspas lavslgqrat iscrasesvd nygisfmnwfqqkpgqppkl liyaasnqgs61gvparfsgsg sgtdfslnih pmeeddtamy fcqqskevpwtfgggsklei kradaaptvs121ifppsseqlt sggasvvcfl nnfypkdinv kwkidgserqngvlnswtdq dskdstysms181stltltkdey erhnsytcea thktstspiv ksfnrnec Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 04F08 (SEQ ID NO:107) 1caggttactc tgaaagagtc tggccctggg atattgcagccctcccagac cctcagtctg61acttgttctt tctctgggtt ttcactgagc acttatggtatgggtgtgac ctggattcgt121cagccttcag gaaagggtct ggagtggctg gcacacatttactgggatga tgacaagcgc181tataacccat ccctgaagag ccggctcaca atctccaaggatacctccaa caaccaggta241ttcctcaaga tcaccagtgt ggacactgca gatactgccacatactactg tgctcaaacg301gggtatagta acttgtttgc ttactggggc caagggactctggtcactgt ctctgcagcc361aaaacgacac ccccatctgt ctatccactg gcccctggatctgctgccca aactaactcc421atggtgaccc tgggatgcct ggtcaagggc tatttccctgagccagtgac agtgacctgg481aactctggat ccctgtccag cggtgtgcac accttcccagctgtcctgca gtctgacctc541tacactctga gcagctcagt gactgtcccc tccagcacctggcccagcga gaccgtcacc601tgcaacgttg cccacccggc cagcagcacc aaggtggacaagaaaattgt gcccagggat661tgtggttgta agccttgcat atgtacagtc ccagaagtatcatctgtctt catcttcccc721ccaaagccca aggatgtgct caccattact ctgactcctaaggtcacgtg tgttgtggta781gacatcagca aggatgatcc cgaggtccag ttcagctggtttgtagatga tgtggaggtg841cacacagctc agacgcaacc ccgggaggag cagttcaacagcactttccg ctcagtcagt901gaacttccca tcatgcacca ggactggctc aatggcaaggagttcaaatg cagggtcaac961agtgcagctt tccctgcccc catcgagaaa accatctccaaaaccaaagg cagaccgaag1021gctccacagg tgtacaccat tccacctccc aaggagcagatggccaagga taaagtcagt1081ctgacctgca tgataacaga cttcttccct gaagacattactgtggagtg gcagtggaat1141gggcagccag cggagaacta caagaacact cagcccatcatggacacaga tggctcttac1201ttcgtctaca gcaagctcaa tgtgcagaag agcaactgggaggcaggaaa tactttcacc1261tgctctgtgt tacatgaggg cctgcacaac caccatactgagaagagcct ctcccactct1321cctggtaaa Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 04F08 (SEQ ID NO:108) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsls tygmgvtwirqpsgkglewl ahiywdddkr61ynpslksrlt iskdtsnnqv flkitsvdta dtatyycaqtgysnlfaywg qgtlvtvsaa121kttppsvypl apgsaaqtns mvtlgclvkg yfpepvtvtwnsgslssgvh tfpavlqsdl181ytlsssvtvp sstwpsetvt cnvahpasst kvdkkivprdcgckpcictv pevssvfifp241pkpkdvltit ltpkvtcvvv diskddpevq fswfvddvevhtaqtqpree qfnstfrsvs301elpimhqdwl ngkefkcrvn saafpapiek tisktkgrpkapqvytippp keqmakdkvs361ltcmitdffp editvewqwn gqpaenyknt qpimdtdgsyfvysklnvqk snweagntft421csvlheglhn hhtekslshs pgk Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 04F08 (SEQ ID NO:109) 1gacattgtga tgacccagtc tcaaaaattc atgtccacatcagtaggaga cagggtcagc61gtcacctgca aggccagtca gaatgtgggt actaatgtagcctggtatca acagaaatta121ggacaatctc ctaaaacact gatttactcg gcatcctaccggtacagtgg agtccctgat181cgcttcacag gcagtggatc tgggacagat ttcactctcaccatcagcaa tgtgcagtct241gaagacttgg cagagtattt ctgtcagcaa tataacagctatccgtacac gttcggaggg301gggaccaagc tggaaataaa acgggctgat gctgcaccaactgtatccat cttcccacca361tccagtgagc agttaacatc tggaggtgcc tcagtcgtgtgcttcttgaa caacttctac421cccaaagaca tcaatgtcaa gtggaagatt gatggcagtgaacgacaaaa tggcgtcctg481aacagttgga ctgatcagga cagcaaagac agcacctacagcatgagcag caccctcacg541ttgaccaagg acgagtatga acgacataac agctatacctgtgaggccac tcacaagaca601tcaacttcac ccattgtcaa gagcttcaac aggaatgagt gt Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 04F08 (SEQ ID NO:110) 1divmtqsqkf mstsvgdrvs vtckasqnvg tnvawyqqklgqspktliys asyrysgvpd61rftgsgsgtd ftltisnvqs edlaeyfcqq ynsypytfgggtkleikrad aaptvsifpp121sseqltsgga svvcflnnfy pkdinvkwki dgserqngvlnswtdqdskd stysmsstlt181ltkdeyerhn sytceathkt stspivksfn rnec Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 06C11 (SEQ ID NO:111) 1caggttactc tgaaagagtc tggccctggg atattgcagccctcccagac cctcagtctg61acttgttctt tctctgggtt ttcactgaac acttatggtatgggtgtgag ctggattcgt121cagccttcag gaaagggtct ggagtggctg gcacacatttactgggatga tgacaagcgc181tataacccat ccctgaagag ccggctcaca atctccaaggatgcctccaa caaccgggtc241ttcctcaaga tcaccagtgt ggacactgca gatactgccacatactactg tgctcaaaga301ggttatgatg attactgggg ttactggggc caagggactctggtcactat ctctgcagcc361aaaacgacac ccccatctgt ctatccactg gcccctggatctgctgccca aactaactcc421atggtgaccc tgggatgcct ggtcaagggc tatttccctgagccagtgac agtgacctgg481aactctggat ccctgtccag cggtgtgcac accttcccagctgtcctgca gtctgacctc541tacactctga gcagctcagt gactgtcccc tccagcacctggcccagcga gaccgtcacc601tgcaacgttg cccacccggc cagcagcacc aaggtggacaagaaaattgt gcccagggat661tgtggttgta agccttgcat atgtacagtc ccagaagtatcatctgtctt catcttcccc721ccaaagccca aggatgtgct caccattact ctgactcctaaggtcacgtg tgttgtggta781gacatcagca aggatgatcc cgaggtccag ttcagctggtttgtagatga tgtggaggtg841cacacagctc agacgcaacc ccgggaggag cagttcaacagcactttccg ctcagtcagt901gaacttccca tcatgcacca ggactggctc aatggcaaggagttcaaatg cagggtcaac961agtgcagctt tccctgcccc catcgagaaa accatctccaaaaccaaagg cagaccgaag1021gctccacagg tgtacaccat tccacctccc aaggagcagatggccaagga taaagtcagt1081ctgacctgca tgataacaga cttcttccct gaagacattactgtggagtg gcagtggaat1141gggcagccag cggagaacta caagaacact cagcccatcatggacacaga tggctcttac1201ttcgtctaca gcaagctcaa tgtgcagaag agcaactgggaggcaggaaa tactttcacc1261tgctctgtgt tacatgaggg cctgcacaac caccatactgagaagagcct ctcccactct1321cctggtaaa Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 06C11 (SEQ ID NO:112) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsln tygmgvswirqpsgkglewl ahiywdddkr61ynpslksrlt iskdasnnrv flkitsvdta dtatyycaqrgyddywgywg qgtlvtisaa121kttppsvypl apgsaaqtns mvtlgclvkg yfpepvtvtwnsgslssgvh tfpavlqsdl181ytlsssvtvp sstwpsetvt cnvahpasst kvdkkivprdcgckpcictv pevssvfifp241pkpkdvltit ltpkvtcvvv diskddpevq fswfvddvevhtaqtqpree qfnstfrsvs301elpimhqdwl ngkefkcrvn saafpapiek tisktkgrpkapqvytippp keqmakdkvs361ltcmitdffp editvewqwn gqpaenyknt qpimdtdgsyfvysklnvqk snweagntft421csvlheglhn hhtekslshs pgk Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 06C11 (SEQ ID NO:113) 1gacattgtga tgacccagtc tcaaaaattc atgtccacatcagtaggaga cagggtcagc61gtcacctgca aggccagtca gaatgtgggt actaatgtagcctggtttca acagaaacca121ggtcaatctc ctaaagcact gatttactcg gcatcttaccggtacagtgg agtccctgat181cgcttcacag gcagtggatc tgggacagat ttcattctcaccatcagcaa tgtgcagtct241gaagacctgg cagagtattt ctgtcagcaa tataacaactatcctctcac gttcggtgct301gggaccaagc tggagctgaa acgggctgat gctgcaccaactgtatccat cttcccacca361tccagtgagc agttaacatc tggaggtgcc tcagtcgtgtgcttcttgaa caacttctac421cccaaagaca tcaatgtcaa gtggaagatt gatggcagtgaacgacaaaa tggcgtcctg481aacagttgga ctgatcagga cagcaaagac agcacctacagcatgagcag caccctcacg541ttgaccaagg acgagtatga acgacataac agctatacctgtgaggccac tcacaagaca601tcaacttcac ccattgtcaa gagcttcaac aggaatgagt gt Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 06C11 (SEQ ID NO:114) 1divmtqsqkf mstsvgdrvs vtckasqnvg tnvawfqqkpgqspkaliys asyrysgvpd61rftgsgsgtd filtisnvqs edlaeyfcqq ynnypltfgagtklelkrad aaptvsifpp121sseqltsgga svvcflnnfy pkdinvkwki dgserqngvlnswtdqdskd stysmsstlt181ltkdeyerhn sytceathkt stspivksfn rnec Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG2b Constant Region) of 08G01 (SEQ ID NO:115) 1gaggtcctgc tgcaacagtc tggacctgag gtggtgaagcctggggcttc agtgaagata61ccctgcaagg cttctggata cacattcact gactacaacatggactgggt gaagcagagc121catggaaaga gccttgagtg gattggagag attaatcctaacaatggtgg tactttctac181aaccagaagt tcaagggcaa ggccacattg actgtagacaagtcctccag cacagcctac241atggagctcc gcagcctgac atctgaggac actgcagtctattactgtgc aagagaggca301attactacgg taggcgctat ggactactgg ggtcaaggaacctcagtcac cgtctcctca361gccaaaacaa cacccccatc agtctatcca ctggcccctgggtgtggaga tacaactggt421tcctccgtga ctctgggatg cctggtcaag ggctacttccctgagtcagt gactgtgact481tggaactctg gatccctgtc cagcagtgtg cacaccttcccagctctcct gcagtctgga541ctctacacta tgagcagctc agtgactgtc ccctccagcacctggccaag tcagaccgtc601acctgcagcg ttgctcaccc agccagcagc accacggtggacaaaaaact tgagcccagc661gggcccattt caacaatcaa cccctgtcct ccatgcaaggagtgtcacaa atgcccagct721cctaacctcg agggtggacc atccgtcttc atcttccctccaaatatcaa ggatgtactc781atgatctccc tgacacccaa ggtcacgtgt gtggtggtggatgtgagcga ggatgaccca841gacgtccaga tcagctggtt tgtgaacaac gtggaagtacacacagctca gacacaaacc901catagagagg attacaacag tactatccgg gtggtcagcaccctccccat ccagcaccag961gactggatga gtggcaagga gttcaaatgc aaggtcaacaacaaagacct cccatcaccc1021atcgagagaa ccatctcaaa aattaaaggg ctagtcagagctccacaagt atacatcttg1081ccgccaccag cagagcagtt gtccaggaaa gatgtcagtctcacttgcct ggtcgtgggc1141ttcaaccctg gagacatcag tgtggagtgg accagcaatgggcatacaga ggagaactac1201aaggacaccg caccagtcct agactctgac ggttcttacttcatatatag caagctcaat1261atgaaaacaa gcaagtggga gaaaacagat tccttctcatgcaacgtgag acacgagggt1321ctgaaaaatt actacctgaa gaagaccatc tcccggtctccgggtaaa Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG2b Constant Region) of 08G01 (SEQ ID NO:116) 1evllqqsgpe vvkpgasvki pckasgytft dynmdwvkqshgkslewige inpnnggtfy61nqkfkgkatl tvdkssstay melrsltsed tavyycareaittvgamdyw gqgtsvtvss121akttppsvyp lapgcgdttg ssvtlgclvk gyfpesvtvtwnsgslsssv htfpallqsg181lytmsssvtv psstwpsqtv tcsvahpass ttvdkklepsgpistinpcp pckechkcpa241pnleggpsvf ifppnikdvl misltpkvtc vvvdvseddpdvqiswfvnn vevhtaqtqt301hredynstir vvstlpiqhq dwmsgkefkc kvnnkdlpspiertiskikg lvrapqvyil361pppaeqlsrk dvsltclvvg fnpgdisvew tsnghteenykdtapvldsd gsyfiyskln421mktskwektd sfscnvrheg lknyylkkti srspgk Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 08G01 (SEQ ID NO:117) 1gacatccaga tgactcagtc tccagcctcc ctatctgcatctgtgggaga aactgtcacc61atcacatgtc gagcaagtgg gaatattcac aattatttagcatggtatca gcagaaacag121ggaaaatctc ctcagctcct ggtctataat gcaaaaaccttagcagatgg tgtgccatca181aggttcagtg gcagtggatc aggaacacaa tattctctcaagatcaacag cctgcagcct241gaagattttg ggagttatta ctgtcaacat ttttggagttctccttacac gttcggaggg301gggaccaagc tggaaataaa acgggctgat gctgcaccaactgtatccat cttcccacca361tccagtgagc agttaacatc tggaggtgcc tcagtcgtgtgcttcttgaa caacttctac421cccaaagaca tcaatgtcaa gtggaagatt gatggcagtgaacgacaaaa tggcgtcctg481aacagttgga ctgatcagga cagcaaagac agcacctacagcatgagcag caccctcacg541ttgaccaagg acgagtatga acgacataac agctatacctgtgaggccac tcacaagaca601tcaacttcac ccattgtcaa gagcttcaac aggaatgagt gt Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 08G01 (SEQ ID NO:118) 1diqmtqspas lsasvgetvt itcrasgnih nylawyqqkqgkspqllvyn aktladgvps61rfsgsgsgtq yslkinslqp edfgsyycqh fwsspytfgggtkleikrad aaptvsifpp121sseqltsgga svvcflnnfy pkdinvkwki dgserqngvlnswtdqdskd stysmsstlt181ltkdeyerhn sytceathkt stspivksfn rnec Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 14F11 (SEQ ID NO:119) 1caggttactc tgaaagagtc tggccctgga atattgcagccctcccagac cctcagtctg61acttgttctt tctctgggtt ttcactgagc acttatggtatgggtgtagg ctggattcgt121cagccttcag gaaagggtct agagtggctg gcagacatttggtgggatga cgataagtac181tataacccat ccctgaagag ccggctcaca atctccaaggatacctccag caatgaggta241ttcctcaaga tcgccattgt ggacactgca gatactgccacttactactg tgctcgaaga301ggtcactact ctgctatgga ctactggggt caaggaacctcagtcaccgt ctcctcagcc361aaaacgacac ccccatctgt ctatccactg gcccctggatctgctgccca aactaactcc421atggtgaccc tgggatgcct ggtcaagggc tatttccctgagccagtgac agtgacctgg481aactctggat ccctgtccag cggtgtgcac accttcccagctgtcctgca gtctgacctc541tacactctga gcagctcagt gactgtcccc tccagcacctggcccagcga gaccgtcacc601tgcaacgttg cccacccggc cagcagcacc aaggtggacaagaaaattgt gcccagggat661tgtggttgta agccttgcat atgtacagtc ccagaagtatcatctgtctt catcttcccc721ccaaagccca aggatgtgct caccattact ctgactcctaaggtcacgtg tgttgtggta781gacatcagca aggatgatcc cgaggtccag ttcagctggtttgtagatga tgtggaggtg841cacacagctc agacgcaacc ccgggaggag cagttcaacagcactttccg ctcagtcagt901gaacttccca tcatgcacca ggactggctc aatggcaaggagttcaaatg cagggtcaac961agtgcagctt tccctgcccc catcgagaaa accatctccaaaaccaaagg cagaccgaag1021gctccacagg tgtacaccat tccacctccc aaggagcagatggccaagga taaagtcagt1081ctgacctgca tgataacaga cttcttccct gaagacattactgtggagtg gcagtggaat1141gggcagccag cggagaacta caagaacact cagcccatcatggacacaga tggctcttac1201ttcgtctaca gcaagctcaa tgtgcagaag agcaactgggaggcaggaaa tactttcacc1261tgctctgtgt tacatgaggg cctgcacaac caccatactgagaagagcct ctcccactct1321cctggtaaa Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 14F11 (SEQ ID NO:120) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsls tygmgvgwirqpsgkglewl adiwwdddky61ynpslksrlt iskdtssnev flkiaivdta dtatyycarrghysamdywg qgtsvtvssa121kttppsvypl apgsaaqtns mvtlgclvkg yfpepvtvtwnsgslssgvh tfpavlqsdl181ytlsssvtvp sstwpsetvt cnvahpasst kvdkkivprdcgckpcictv pevssvfifp241pkpkdvltit ltpkvtcvvv diskddpevq fswfvddvevhtaqtqpree qfnstfrsvs301elpimhqdwl ngkefkcrvn saafpapiek tisktkgrpkapqvytippp keqmakdkvs361ltcmitdffp editvewqwn gqpaenyknt qpimdtdgsyfvysklnvqk snweagntft421csvlheglhn hhtekslshs pgk Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 14F11 (SEQ ID NO:121) 1gacattgtaa tgacccagtc tcaaaaattc atgtccacatcagtaggaga cagggtcagc61gtcacctgca aggccagtca gaatgtgggt actaatgtagcctggtatca acagaaacca121gggcaatctc ctaaagcact gatttactcg ccatcctaccggtacagtgg agtccctgat181cgcttcacag gcagtggatc tgggacagat ttcactctcaccatcagcaa tgtgcagtct241gaagacttgg cagaatattt ctgtcagcaa tataacagctatcctcacac gttcggaggg301gggaccaagc tggaaatgaa acgggctgat gctgcaccaactgtatccat cttcccacca361tccagtgagc agttaacatc tggaggtgcc tcagtcgtgtgcttcttgaa caacttctac421cccaaagaca tcaatgtcaa gtggaagatt gatggcagtgaacgacaaaa tggcgtcctg481aacagttgga ctgatcagga cagcaaagac agcacctacagcatgagcag caccctcacg541ttgaccaagg acgagtatga acgacataac agctatacctgtgaggccac tcacaagaca601tcaacttcac ccattgtcaa gagcttcaac aggaatgagt gt Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 14F11 (SEQ ID NO:122) 1divmtqsqkf mstsvgdrvs vtckasqnvg tnvawyqqkpgqspkaliys psyrysgvpd61rftgsgsgtd ftltisnvqs edlaeyfcqq ynsyphtfgggtklemkrad aaptvsifpp121sseqltsgga svvcflnnfy pkdinvkwki dgserqngvlnswtdqdskd stysmsstlt181ltkdeyerhn sytceathkt stspivksfn rnec Nucleic Acid Sequence Encoding the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 17B11 (SEQ ID NO:123) 1caggttactc tgaaagagtc tggccctggg atattgcagccctcccagac cctcagtctg61acttgttctt tctctgggtt ttcactgagc acttctggtatgggtgtgag ttggattcgt121cagccttcag gaaagggtct ggagtggctg gcacacaatgactgggatga tgacaagcgc181tataagtcat ccctgaagag ccggctcaca atatccaaggatacctccag aaaccaggta241ttcctcaaga tcaccagtgt ggacactgca gatactgccacatactactg tgctcgaaga301gttgggggat tagagggcta ttttgattac tggggccaaggcaccactct cacagtctcc361tcagccaaaa cgacaccccc atctgtctat ccactggcccctggatctgc tgcccaaact421aactccatgg tgaccctggg atgcctggtc aagggctatttccctgagcc agtgacagtg481acctggaact ctggatccct gtccagcggt gtgcacaccttcccagctgt cctgcagtct541gacctctaca ctctgagcag ctcagtgact gtcccctccagcacctggcc cagcgagacc601gtcacctgca acgttgccca cccggccagc agcaccaaggtggacaagaa aattgtgccc661agggattgtg gttgtaagcc ttgcatatgt acagtcccagaagtatcatc tgtcttcatc721ttccccccaa agcccaagga tgtgctcacc attactctgactcctaaggt cacgtgtgtt781gtggtagaca tcagcaagga tgatcccgag gtccagttcagctggtttgt agatgatgtg841gaggtgcaca cagctcagac gcaaccccgg gaggagcagttcaacagcac tttccgctca901gtcagtgaac ttcccatcat gcaccaggac tggctcaatggcaaggagtt caaatgcagg961gtcaacagtg cagctttccc tgcccccatc gagaaaaccatctccaaaac caaaggcaga1021ccgaaggctc cacaggtgta caccattcca cctcccaaggagcagatggc caaggataaa1081gtcagtctga cctgcatgat aacagacttc ttccctgaagacattactgt ggagtggcag1141tggaatgggc agccagcgga gaactacaag aacactcagcccatcatgga cacagatggc1201tcttacttcg tctacagcaa gctcaatgtg cagaagagcaactgggaggc aggaaatact1261ttcacctgct ctgtgttaca tgagggcctg cacaaccaccatactgagaa gagcctctcc1321cactctcctg gtaaa Protein Sequence Defining the Full Length Heavy Chain Sequence (Heavy Chain Variable Region and IgG1 Constant Region) of 17B11 (SEQ ID NO:124) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsls tsgmgvswirqpsgkglewl ahndwdddkr61yksslksrlt iskdtsrnqv flkitsvdta dtatyycarrvgglegyfdy wgqgttltvs121sakttppsvy plapgsaaqt nsmvtlgclv kgyfpepvtvtwnsgslssg vhtfpavlqs181dlytlsssvt vpsstwpset vtcnvahpas stkvdkkivprdcgckpcic tvpevssvfi241fppkpkdvlt itltpkvtcv vvdiskddpe vqfswfvddvevhtaqtqpr eeqfnstfrs301vselpimhqd wlngkefkcr vnsaafpapi ektisktkgrpkapqvytip ppkeqmakdk361vsltcmitdf fpeditvewq wngqpaenyk ntqpimdtdgsyfvysklnv qksnweagnt421ftcsvlhegl hnhhteksls hspgk Nucleic Acid Sequence Encoding the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 17B11 (SEQ ID NO:125) 1gacattgtgc tgacacagtc tcctgcttcc ttagctgtatctctggggca gagggccacc61atctcatgca gggccagcca aagtgtcagt acatctaggtttagttatat gcactggttc121caacagaaac caggacaggc acccaaactc ctcatcaagtatgcatccaa cctagaatct181ggggtccctg ccaggttcag tggcagtggg tctgggacagacttcaccct caacatccat241cctgtggagg gggaggatac tgcaacatat tactgtcagcacagttggga gattccgtac301acgttcggag gggggaccaa gctggaaata aaacgggctgatgctgcacc aactgtatcc361atcttcccac catccagtga gcagttaaca tctggaggtgcctcagtcgt gtgcttcttg421aacaacttct accccaaaga catcaatgtc aagtggaagattgatggcag tgaacgacaa481aatggcgtcc tgaacagttg gactgatcag gacagcaaagacagcaccta cagcatgagc541agcaccctca cgttgaccaa ggacgagtat gaacgacataacagctatac ctgtgaggcc601actcacaaga catcaacttc acccattgtc aagagcttcaacaggaatga gtgt Protein Sequence Defining the Full Length Light Chain Sequence (Kappa Chain Variable Region and Constant Region) of 17B11 (SEQ ID NO:126) 1divltqspas lavslgqrat iscrasqsvs tsrfsymhwfqqkpgqapkl likyasnles61gvparfsgsg sgtdftlnih pvegedtaty ycqhsweipytfgggtklei kradaaptvs121ifppsseqlt sggasvvcfl nnfypkdinv kwkidgserqngvlnswtdq dskdstysms181stltltkdey erhnsytcea thktstspiv ksfnrnec Table 5 shows the correspondence between the full-length sequences of the antibodies discussed in this Example with those presented in the Sequence Listing. TABLE 5SEQ ID NO.Nucleic Acid or Protein9901G06_Heavy Variable + IgG1 Constant-nucleic acid10001G06_Heavy Variable + IgG1 Constant-protein10101G06_Kappa Variable + Constant-nucleic acid10201G06_Kappa Variable + Constant-protein10303G05 Heavy Variable + IgG1 Constant-nucleic acid10403G05 Heavy Variable + IgG1 Constant-protein10503G05 Kappa Variable + Constant-nucleic acid10603G05 Kappa Variable + Constant-protein10704F08 Heavy Variable + IgG1 Constant-nucleic acid10804F08 Heavy Variable + IgG1 Constant-protein10904F08 Kappa Variable + Constant-nucleic acid11004F08 Kappa Variable + Constant-protein11106C11 Heavy Variable + IgG1 Constant-nucleic acid11206C11 Heavy Variable + IgG1 Constant-protein11306C11 Kappa Variable + Constant-nucleic acid11406C11 Kappa Variable + Constant-protein11508G01 Heavy Variable + IgG2b Constant-nucleic acid11608G01 Heavy Variable + IgG2b Constant-protein11708G01 Kappa Variable + Constant-nucleic acid11808G01 Kappa Variable + Constant-protein11914F11 Heavy Variable + IgG1 Constant-nucleic acid12014F11 Heavy Variable + IgG1 Constant-protein12114F11 Kappa Variable + Constant-nucleic acid12214F11 Kappa Variable + Constant-protein12317B11 Heavy Variable + IgG1 Constant-nucleic acid12417B11 Heavy Variable + IgG1 Constant-protein12517B11 Kappa Variable + Constant-nucleic acid12617B11 Kappa Variable + Constant-protein Example 8 Binding Affinities The binding affinities and kinetics of binding of antibodies to 6×His tagged (SEQ ID NO: 266) recombinant human GDF15 (His-rhGDF15 (R&D Systems, Inc.)), untagged recombinant human GDF15 (rhGDF15 (Peprotech, Rocky Hill, N.J.), and recombinant human GDF15 produced as either mouse Fc fused to human GDF15 (mFc-rhGDF15) or a version in which the Fc was enzymatically removed (cleaved-rhGDF15) were measured by surface plasmon resonance, using a Biacore® T100 instrument (GE Healthcare, Piscataway, N.J.). Rabbit anti-mouse IgGs (GE Healthcare) were immobilized on carboxymethylated dextran CM4 sensor chips (GE Healthcare) by amine coupling, according to a standard protocol. Analyses were performed at 37° C. using PBS containing 0.05% surfactant P20 as running buffer. The antibodies were captured in individual flow cells at a flow rate of 10 μL/minute. Injection time was varied for each antibody to yield an Rmax between 30 and 60 RU. 250 μg/mL mouse Fc (Jackson ImmunoResearch, West Grove, Pa.) was injected at 30 μL/minute for 120 seconds to block non-specific binding of capture antibodies to mouse Fc portion of the recombinant GDF15 protein when needed. Buffer, mFc-rhGDF15, cleaved-rhGDF15, His-rhGDF15, or rhGDF15 diluted in running buffer was injected sequentially over a reference surface (no antibody captured) and the active surface (antibody to be tested) for 240 seconds at 60 μL/minute. The dissociation phase was monitored for up to 1500 seconds. The surface was then regenerated with two 60-second injections of 10 mM Glycine-HCl, pH 1.7, at a flow rate of 30 μL/minute. The GDF15 concentration range tested was 30 nM to 0.625 nM. Kinetic parameters were determined using the kinetic function of the BIAevaluation software (GE Healthcare) with double reference subtraction. Kinetic parameters for each antibody, k a (association rate constant), k d (dissociation rate constant), and K D (equilibrium dissociation constant) were determined Kinetic values of the monoclonal antibodies on mFc-rhGDF15, cleaved rhGDF15, His-rhGDF15, or rhGDF15 are summarized in Tables 6, 7, 8, and 9, respectively. TABLE 6Antibody Binding to mFc-rhGDF15Antibodyk a (1/Ms)k d (1/s)K D (M)n01G065.6E+067.0E−042.1E−10703G051.0E+076.4E−046.9E−11304F083.6E+066.4E−041.9E−10306C114.5E+066.8E−041.7E−10508G016.0E+061.1E−031.9E−10414F111.7E+063.3E−042.2E−10417B113.7E+065.1E−041.4E−103 The data in Table 6 demonstrate that antibodies bind mFc-rhGDF15 with a K D of about 250 pM or less, 200 pM or less, 150 pM or less, 100 pM or less, 75 pM or less, or 50 pM or less. Kinetic values of the monoclonal antibodies on cleaved-rhGDF15 are summarized in Table 7. TABLE 7Antibody Binding to Cleaved-rhGDF15Antibodyk a (1/Ms)k d (1/s)K D (M)n01G067.5E+068.6E−041.1E−10106C111.2E+072.0E−031.7E−10214F115.7E+066.0E−041.1E−101 The data in Table 7 demonstrate that antibodies 01G06, 06C11 and 14F11 bind cleaved-rhGDF15 with a K D of about 200 pM or less, 150 pM or less, or 100 pM or less. Kinetic values of the monoclonal antibodies on His-rhGDF15 are summarized in Table 8. TABLE 8Antibody Binding to His-rhGDF15Antibodyk a (1/Ms)k d (1/s)K D (M)n01G061.4E+071.1E−038.1E−11206C112.9E+071.5E−035.1E−11214F114.4E+064.2E−049.6E−111 The data in Table 8 demonstrate that antibodies 01G06, 06C11 and 14F11 bind His-rhGDF15 with a K D of about 150 pM or less, 100 pM or less, 75 pM or less, or 50 pM or less. Kinetic values of the monoclonal antibodies on rhGDF15 are summarized in Table 9. TABLE 9Antibody Binding to rhGDF15Antibodyk a (1/Ms)k d (1/s)K D (M)n01G062.1E+071.9E−039.3E−11106C112.2E+074.6E−032.1E−10114F113.1E+072.2E−037.1E−111 The data in Table 9 demonstrate that antibodies 01G06, 06C11 and 14F11 bind rhGDF15 with a K D of about 250 pM or less, 200 pM or less, 150 pM or less, 100 pM or less, 75 pM or less, or 50 pM or less. Example 9 Reversal of Cachexia in an mFc-rhGDF15-Induced Model This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by antibody 01G06, 03G05, 04F08, 06C11, 14F11, or 17B11 in an mFc-rhGDF15-induced cachexia model. mFc-rhGDF15 (2 μg/g) was administered subcutaneously into the flank of 8-week old female ICR-SCID mice. Body weight was measured daily. When body weight reached 93%, the mice were randomized into seven groups of ten mice each. Each group received one of the following treatments: murine IgG control, 01G06, 03G05, 04F08, 06C11, 14F11, or 17B11 at 10 mg/kg. Treatment was administered once by intra-peritoneal injection. Treatment with antibody 01G06, 03G05, 04F08, 06C11, 14F11, or 17B11 resulted in body weight increase relative to initial weight or about 100% (p<0.001) ( FIG. 14 and Table 10). TABLE 10Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to mIgG)1mIgG1077.1NA201G061094.1p < 0.001303G051095.1p < 0.001404F081095.8p < 0.001506C111093.8p < 0.001714F111095.4p < 0.001817B111092.8p < 0.001 The data in FIG. 14 and Table 10 indicate that the disclosed anti-GDF15 antibodies can reverse cachexia in an mFc-rhGDF15-induced mouse model (i.e., a non-tumor bearing mouse model). Example 10 Reversal of Cachexia in an HT-1080 Xenograft Tumor Model This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 in an HT-1080 fibrosarcoma xenograft model. HT-1080 cells were grown in culture at 37° C. in an atmosphere containing 5% CO 2 , using Eagle's Minimum Essential Medium (ATCC, Catalog No. 30-2003) containing 10% FBS. Cells were inoculated subcutaneously into the flank of 8-week old female ICR SCID mice with 5×10 6 cells per mouse in 50% matrigel. Body weight was measured daily. When body weight reached 93%, the mice were randomized into eight groups of ten mice each. Each group received one of the following treatments: murine IgG control, 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 at 10 mg/kg. Treatment was administered every three days by intra-peritoneal injection. Treatment with antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 resulted in body weight increase relative to initial weight or about 100% (p<0.001) ( FIG. 15 and Table 11). TABLE 11Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to mIgG)1mIgG1081.4NA201G0610103.3p < 0.001303G0510106.1p < 0.001404F0810104.3p < 0.001506C1110106.6p < 0.001608G0110105.3p < 0.001714F111099.6p < 0.001817B1110103.7p < 0.001 The data in FIG. 15 and Table 11 indicate that the disclosed anti-GDF15 antibodies can reverse cachexia in an HT-1080 fibrosarcoma xenograft model. Additional studies were conducted with antibody 01G06 to demonstrate the reversal of cachexia in this mouse model. HT-1080 cells were grown and inoculated subcutaneously into the flank of 8-week old female ICR SCID mice as described above. When body weight reached 93%, the mice were randomized into two groups of ten mice each. Each group received one of the following treatments: murine IgG control or 01G06 at 10 mg/kg. Treatment was administered once by intra-peritoneal injection. As shown in FIG. 16A , treatment with antibody 01G06 resulted in body weight increase to initial weight or 100% (p<0.001) ( FIG. 16A ). Food consumption was determined by weighing the food supply given to the mice daily ( FIG. 16B ). A significant increase in food consumption was observed in the 01G06 treated group for the first three days post treatment. After that time, no significant change was observed compared to the control group (mIgG). Water consumption was determined by weighing the water supply given to the mice daily. No significant change in water consumption was observed between groups. In this experiment, a group of ten mice were sacrificed at the time of the dose (baseline or 93% body weight, without treatment) and at the end of study (seven days post dose, either mIgG or 01G06). Gonadal fat and the gastrocnemius muscles were removed surgically and weighed as described above in Example 4 and tissues were snap frozen in liquid nitrogen. RNA was isolated from the gastrocnemius muscle samples to determine the levels of mMuRF1 and mAtrogin mRNA by RT-PCR, as described in Example 4. As shown in FIG. 16C , a significant reduction in gonadal fat mass was observed seven days post dose with mIgG, but not in the group treated with antibody 01G06. In addition, mice treated with mIgG displayed significant gastrocnemius muscle loss compared to the baseline group, while the group of mice treated with antibody 01G06 did not ( FIG. 16D ). Further, the levels of muscular degradation markers, mMuRF1 and mAtrogin, were significantly higher in the mIgG group compared to the 01G06 group ( FIG. 16E ). These results indicate that the disclosed anti-GDF15 antibodies can reverse cachexia measured by the loss of muscle mass, the loss of fat and involuntary weight loss in an HT-1080 xenograft tumor model. Example 11 Reversal of Cachexia in an HT-1080 Xenograft Tumor Model This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by antibody 01G06 in an HT-1080 fibrosarcoma xenograft model. HT-1080 cells were grown in culture at 37° C. in an atmosphere containing 5% CO 2 , using Eagle's Minimum Essential Medium (ATCC, Catalog No. 30-2003) containing 10% FBS. Cells were inoculated subcutaneously into the flank of 8-week old female ICR SCID mice with 5×10 6 cells per mouse in 50% matrigel. Body weight was measured daily. When body weight reached 80%, the mice were randomized into two groups of five mice each. Each group received one of the following treatments: murine IgG control, 01G06 dosed at 2 mg/kg on day 1 and day 7. Treatment was administered by intra-peritoneal injection. Treatment with antibody 01G06 resulted in body weight increase relative to initial weight or about 100% (p<0.001) ( FIG. 17A and Table 12). TABLE 12Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to mIgG)1mIgG266.4NA201G06297.16p < 0.001 The data in FIGS. 17A-B and Table 12 indicate that the disclosed anti-GDF15 antibodies can reverse cachexia in an HT-1080 fibrosarcoma xenograft model. In this experiment, a group of five mice were sacrificed at the time of dosing (baseline or 80% body weight loss, without treatment) and at the end of study (seven days post dose, either mIgG or 01G06). Liver, heart, spleen, kidney, gonadal fat and the gastrocnemius muscles were removed surgically and weighed. As shown in FIG. 17B , a significant loss in liver, heart, spleen, kidney, gonadal fat and gastrocnemius muscle mass was observed seven days post dose with mIgG, but not in the group treated with antibody 01G06. In addition, mice treated with antibody 01G06 displayed significant liver and gonadal muscle gain compared to the baseline group ( FIG. 17B ). These results indicate that the disclosed anti-GDF15 antibodies can reverse cachexia measured by the loss of key organ mass, loss of muscle mass, loss of fat and involuntary weight loss in an HT-1080 xenograft tumor model. Example 12 Reversal of Cachexia in a K-562 Xenograft Tumor Model This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 in a K-562 leukemia xenograft model. K-562 cells were grown in culture at 37° C. in an atmosphere containing 5% CO 2 , using Iscove's Modified Dulbecco's Medium (ATCC Catalog No. 30-2005) containing 10% FBS. Cells were inoculated subcutaneously into the flank of 8-week old female CB17SCRFMF mice with 2.5×10 6 cells per mouse in 50% matrigel. Body weight was measured daily. When body weight reached 93%, the mice were randomly distributed into eight groups of ten mice each. Each group received one of the following treatments: murine IgG control, 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 at 10 mg/kg. Treatment was administered every three days by intra-peritoneal injection. Treatment with antibody 01G06, 03G05, 04F08, 06C11, 08G01, 14F11 or 17B11 resulted in body weight increase relative to initial weight or about 100% (p<0.001) ( FIG. 18 and Table 13). TABLE 13Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to mIgG)1mIgG1090.4NA201G0610106.5p < 0.001303G0510109.8p < 0.001404F0810108.9p < 0.001506C1110109.5p < 0.001608G0110107.2p < 0.001714F1110107.0p < 0.001817B1110105.3p < 0.001 The data in FIG. 18 and Table 13 indicate that the disclosed anti-GDF15 antibodies can reverse cachexia in a K-562 xenograft tumor model. Example 13 Additional Xenograft Tumor Models Antibody 01G06 was tested in additional tumor xenograft models including the TOV-21G ovarian xenograft model and the LS1034 colon xenograft model. In each model, antibody 01G06 reversed body weight loss compared to a PBS control (p<0.001 for the TOV-21G model and p<0.01 for the LS1034 model). Example 14 Humanization of Anti-GDF15 Antibodies This Example describes the humanization and chimerization of three murine antibodies, designated 01G06, 06C11, and 14F11, and the characterization of the resulting humanized antibodies. The humanized anti-GDF15 antibodies were designed, affinity matured by targeted CDR mutagenesis, and optimized using methods known in the art. The amino acid sequences were converted to codon-optimized DNA sequences and synthesized to include (in the following order): 5′ HindIII restriction site, Kozak consensus sequence, amino terminal signal sequence, humanized variable region, human IgG1 or Kappa constant region, stop codon, and a 3′ EcoRI restriction site. Chimeric (murine variable region and human constant region) 01G06, 06C11, and 14F11 heavy (human IgG1) and light (human Kappa) chains were also constructed. To generate chimeric antibodies, the murine variable regions were fused to the human constant region, and codon-optimized DNA sequences were synthesized, including (in the following order): 5′ HindIII restriction site, Kozak consensus sequence, amino terminal signal sequence, mouse variable region, human IgG1 or Kappa constant region, stop codon, and 3′ EcoRI restriction site. The humanized and chimeric heavy chains were subcloned into pEE6.4 (Lonza, Basel, Switzerland) via HindIII and EcoRI sites using In-Fusion™ PCR cloning (Clontech, Mountain View, Calif.). The humanized and chimeric Kappa light chains were subcloned into pEE14.4 (Lonza) via HindIII and EcoRI sites using In-Fusion™ PCR cloning. Humanized antibody chains or chimeric antibody chains were transiently transfected into 293T cells to produce antibody. Antibody was either purified or used in cell culture media supernatant for subsequent in vitro analysis. Binding of the chimeric and humanized antibodies to human GDF15 was measured as described below. The results are summarized in Tables 24-27. Each of the possible combinations of the chimeric or humanized 01G06 immunoglobulin heavy chain and immunoglobulin light chain variable regions is set forth below in Table 14. TABLE 14Antibody NameLight Chain Variable RegionHeavy Chain Variable RegionHu01G06-1Ch01G06 Chimeric KappaCh01G06 Chimeric Heavy(SEQ ID NO: 76)(SEQ ID NO: 40)Hu01G06-14Ch01G06 Chimeric KappaHu01G06 IGHV1-18 Heavy(SEQ ID NO: 76)(SEQ ID NO: 54)Hu01G06-15Ch01G06 Chimeric KappaHu01G06 IGHV1-69 Heavy(SEQ ID NO: 76)(SEQ ID NO: 56)Hu01G06-147Ch01G06 Chimeric KappaSh01G06 IGHV1-18 M69L Heavy(SEQ ID NO: 76)(SEQ ID NO: 58)Hu01G06-148Ch01G06 Chimeric KappaSh01G06 IGHV1-18 M69L K64Q G44S Heavy(SEQ ID NO: 76)(SEQ ID NO: 60)Hu01G06-149Ch01G06 Chimeric KappaSh01G06 IGHV1-18 M69L K64Q Heavy(SEQ ID NO: 76)(SEQ ID NO: 62)Hu01G06-150Ch01G06 Chimeric KappaSh01G06 IGHV1-69 T30S I69L Heavy(SEQ ID NO: 76)(SEQ ID NO: 64)Hu01G06-151Ch01G06 Chimeric KappaSh01G06 IGHV1-69 T30S K64Q I69L Heavy(SEQ ID NO: 76)(SEQ ID NO: 66)Hu01G06-4Hu01G06 IGKV1-39 KappaCh01G06 Chimeric Heavy(SEQ ID NO: 90)(SEQ ID NO: 40)Hu01G06-46Hu01G06 IGKV1-39 KappaHu01G06 IGHV1-18 Heavy(SEQ ID NO: 90)(SEQ ID NO: 54)Hu01G06-52Hu01G06 IGKV1-39 KappaHu01G06 IGHV1-69 Heavy(SEQ ID NO: 90)(SEQ ID NO: 56)Hu01G06-100Hu01G06 IGKV1-39 KappaSh01G06 IGHV1-18 M69L Heavy(SEQ ID NO: 90)(SEQ ID NO: 58)Hu01G06-102Hu01G06 IGKV1-39 KappaSh01G06 IGHV1-18 M69L K64Q G44S Heavy(SEQ ID NO: 90)(SEQ ID NO: 60)Hu01G06-101Hu01G06 IGKV1-39 KappaSh01G06 IGHV1-18 M69L K64Q Heavy(SEQ ID NO: 90)(SEQ ID NO: 62)Hu01G06-103Hu01G06 IGKV1-39 KappaSh01G06 IGHV1-69 T30S I69L Heavy(SEQ ID NO: 90)(SEQ ID NO: 64)Hu01G06-104Hu01G06 IGKV1-39 KappaSh01G06 IGHV1-69 T30S K64Q I69L Heavy(SEQ ID NO: 90)(SEQ ID NO: 66)Hu01G06-152Hu01G06 IGKV1-39 S43A V48ICh01G06 Chimeric HeavyKappa (SEQ ID NO: 92)(SEQ ID NO: 40)Hu01G06-71Hu01G06 IGKV1-39 S43A V48IHu01G06 IGHV1-18 HeavyKappa (SEQ ID NO: 92)(SEQ ID NO: 54)Hu01G06-77Hu01G06 IGKV1-39 S43A V48IHu01G06 IGHV1-69 HeavyKappa (SEQ ID NO: 92)(SEQ ID NO: 56)Hu01G06-110Hu01G06 IGKV1-39 S43A V48ISh01G06 IGHV1-18 M69L HeavyKappa (SEQ ID NO: 92)(SEQ ID NO: 58)Hu01G06-112Hu01G06 IGKV1-39 S43A V48ISh01G06 IGHV1-18 M69L K64Q G44S HeavyKappa (SEQ ID NO: 92)(SEQ ID NO: 60)Hu01G06-111Hu01G06 IGKV1-39 S43A V48ISh01G06 IGHV1-18 M69L K64Q HeavyKappa (SEQ ID NO: 92)(SEQ ID NO: 62)Hu01G06-113Hu01G06 IGKV1-39 S43A V48ISh01G06 IGHV1-69 T30S I69L HeavyKappa(SEQ ID NO: 92)(SEQ ID NO: 64)Hu01G06-114Hu01G06 IGKV1-39 S43A V48ISh01G06 IGHV1-69 T30S K64Q I69L HeavyKappa (SEQ ID NO: 92)(SEQ ID NO: 66)Hu01G06-122Hu01G06 IGKV1-39 S43A V48IHu01G06 IGHV1-18 F1 HeavyKappa(SEQ ID NO: 92)(SEQ ID NO: 246)Hu01G06-119Hu01G06 IGKV1-39 S43A V48IHu01G06 IGHV1-18 F2 HeavyKappa(SEQ ID NO: 92)(SEQ ID NO: 248)Hu01G06-135Hu01G06 IGKV1-39 S43A V48IHu01G06 IGHV1-69 F1 HeavyKappa(SEQ ID NO: 92)(SEQ ID NO: 250)Hu01G06-138Hu01G06 IGKV1-39 S43A V48IHu01G06 IGHV1-69 F2 HeavyKappa(SEQ ID NO: 92)(SEQ ID NO: 252)Hu01G06-153Hu01G06 IGKV1-39 V48I KappaCh01G06 Chimeric Heavy(SEQ ID NO: 94)(SEQ ID NO: 40)Hu01G06-69Hu01G06 IGKV1-39 V48I KappaHu01G06 IGHV1-18 Heavy(SEQ ID NO: 94)(SEQ ID NO: 54)Hu01G06-75Hu01G06 IGKV1-39 V48I KappaHu01G06 IGHV1-69 Heavy(SEQ ID NO: 94)(SEQ ID NO: 56)Hu01G06-105Hu01G06 IGKV1-39 V48I KappaSh01G06 IGHV1-18 M69L Heavy(SEQ ID NO: 94)(SEQ ID NO: 58)Hu01G06-107Hu01G06 IGKV1-39 V48I KappaSh01G06 IGHV1-18 M69L K64Q G44S Heavy(SEQ ID NO: 94)(SEQ ID NO: 60)Hu01G06-106Hu01G06 IGKV1-39 V48I KappaSh01G06 IGHV1-18 M69L K64Q Heavy(SEQ ID NO: 94)(SEQ ID NO: 62)Hu01G06-108Hu01G06 IGKV1-39 V48I KappaSh01G06 IGHV1-69 T30S I69L Heavy(SEQ ID NO: 94)(SEQ ID NO: 64)Hu01G06-109Hu01G06 IGKV1-39 V48I KappaSh01G06 IGHV1-69 T30S K64Q I69L Heavy(SEQ ID NO: 94)(SEQ ID NO: 66)Hu01G06-154Hu01G06 IGKV1-39 F2 KappaCh01G06 Chimeric Heavy(SEQ ID NO: 254)(SEQ ID NO: 40)Hu01G06-155Hu01G06 IGKV1-39 F2 KappaHu01G06 IGHV1-18 Heavy(SEQ ID NO: 254)(SEQ ID NO: 54)Hu01G06-156Hu01G06 IGKV1-39 F2 KappaHu01G06 IGHV1-69 Heavy(SEQ ID NO: 254)(SEQ ID NO: 56)Hu01G06-157Hu01G06 IGKV1-39 F2 KappaSh01G06 IGHV1-18 M69L Heavy(SEQ ID NO: 254)(SEQ ID NO: 58)Hu01G06-158Hu01G06 IGKV1-39 F2 KappaSh01G06 IGHV1-18 M69L K64Q G44S Heavy(SEQ ID NO: 254)(SEQ ID NO: 60)Hu01G06-159Hu01G06 IGKV1-39 F2 KappaSh01G06 IGHV1-18 M69L K64Q Heavy(SEQ ID NO: 254)(SEQ ID NO: 62)Hu01G06-160Hu01G06 IGKV1-39 F2 KappaSh01G06 IGHV1-69 T30S I69L Heavy(SEQ ID NO: 254)(SEQ ID NO: 64)Hu01G06-161Hu01G06 IGKV1-39 F2 KappaSh01G06 IGHV1-69 T30S K64Q I69L Heavy(SEQ ID NO: 254)(SEQ ID NO: 66)Hu01G06-130Hu01G06 IGKV1-39 F2 KappaHu01G06 IGHV1-18 F1 Heavy(SEQ ID NO: 254)(SEQ ID NO: 246)Hu01G06-127Hu01G06 IGKV1-39 F2 KappaHu01G06 IGHV1-18 F2 Heavy(SEQ ID NO: 254)(SEQ ID NO: 248)Hu01G06-143Hu01G06 IGKV1-39 F2 KappaHu01G06 IGHV1-69 F1 Heavy(SEQ ID NO: 254)(SEQ ID NO: 250)Hu01G06-146Hu01G06 IGKV1-39 F2 KappaHu01G06 IGHV1-69 F2 Heavy(SEQ ID NO: 254)(SEQ ID NO: 252) Each of the possible combinations of the chimeric or humanized 06C11 immunoglobulin heavy chain and immunoglobulin light chain variable regions is set forth below in Table 15. TABLE 15AntibodyLight Chain VariableHeavy Chain VariableNameRegionRegionHu06C11-1Ch06C11 Chimeric KappaCh06C11 Chimeric Heavy(SEQ ID NO: 82)(SEQ ID NO: 46)Hu06C11-7Ch06C11 Chimeric KappaHE LM 06C11 IGHV2-70(SEQ ID NO: 82)Heavy (SEQ ID NO: 68)Hu06C11-10Ch06C11 Chimeric KappaHu06C11 IGHV2-5 Heavy(SEQ ID NO: 82)(SEQ ID NO: 70)Hu06C11-12Sh06C11 IGKV1-16 KappaCh06C11 Chimeric Heavy(SEQ ID NO: 96)(SEQ ID NO: 46)Hu06C11-27Sh06C11 IGKV1-16 KappaHE LM 06C11 IGHV2-70(SEQ ID NO: 96)Heavy (SEQ ID NO: 68)Hu06C11-30Sh06C11 IGKV1-16 KappaHu06C11 IGHV2-5 Heavy(SEQ ID NO: 96)(SEQ ID NO: 70) Each of the possible combinations of the chimeric or humanized 14F11 immunoglobulin heavy chain and immunoglobulin light chain variable regions is set forth below in Table 16. TABLE 16AntibodyLight Chain VariableHeavy Chain VariableNameRegionRegionHu14F11-1Ch14F11 Chimeric KappaCh14F11 Chimeric Heavy(SEQ ID NO: 86)(SEQ ID NO: 50)Hu14F11-14Ch14F11 Chimeric KappaSh14F11 IGHV2-5 Heavy(SEQ ID NO: 86)(SEQ ID NO: 72)Hu14F11-15Ch14F11 Chimeric KappaSh14F11 IGHV2-70 Heavy(SEQ ID NO: 86)(SEQ ID NO: 74)Hu14F11-11Hu14F11 IGKV1-16 KappaCh14F11 Chimeric Heavy(SEQ ID NO: 98)(SEQ ID NO: 50)Hu14F11-39Hu14F11 IGKV1-16 KappaSh14F11 IGHV2-5 Heavy(SEQ ID NO: 98(SEQ ID NO: 72)Hu14F11-47Hu14F11 IGKV1-16 KappaSh14F11 IGHV2-70 Heavy(SEQ ID NO: 98)(SEQ ID NO: 74) Each of the possible combinations of the chimeric 04F08, 06C11, and 14F11 immunoglobulin heavy chain and immunoglobulin light chain variable regions is set forth below in Table 17. TABLE 17Light Chain Variable RegionHeavy Chain Variable Region04F08 Chimeric KappaCh06C11 Chimeric Heavy(SEQ ID NO: 80)(SEQ ID NO: 46)04F08 Chimeric KappaCh14F11 Chimeric Heavy(SEQ ID NO: 80)(SEQ ID NO: 50)Ch06C11 Chimeric Kappa04F08 Chimeric Heavy(SEQ ID NO: 82)(SEQ ID NO: 44)Ch06C11 Chimeric KappaCh14F11 Chimeric Heavy(SEQ ID NO: 82)(SEQ ID NO: 50)Ch14F11 Chimeric Kappa04F08 Chimeric Heavy(SEQ ID NO: 86)(SEQ ID NO: 44)Ch14F11 Chimeric KappaCh06C11 Chimeric Heavy(SEQ ID NO: 86)(SEQ ID NO: 46) Each of the possible combinations of the chimeric 01G06 and chimeric 08G01 immunoglobulin heavy chain and immunoglobulin light chain variable regions is set forth below in Table 18. TABLE 18Light Chain Variable RegionHeavy Chain Variable RegionCh01G06 Chimeric Kappa08G01 Chimeric Heavy(SEQ ID NO: 76)(SEQ ID NO: 48)08G01 Chimeric KappaCh01G06 Chimeric Heavy(SEQ ID NO: 84)(SEQ ID NO: 40) The nucleic acid sequences and the encoded protein sequences defining variable regions of the chimeric and humanized 01G06, 06C11, and 14F11 antibodies are summarized below (amino terminal signal peptide sequences are not shown). CDR sequences (Kabat definition) are shown in bold and are underlined in the amino acid sequences. Nucleic Acid Sequence Encoding the Ch01G06 Chimeric Heavy Chain Variable Region (SEQ ID NO:127) 1gaagtgttgt tgcagcagtc agggccggag ttggtaaaaccgggagcgtc ggtgaaaatc61ccgtgcaaag cgtcggggta tacgtttacg gactataacatggattgggt gaaacagtcg121catgggaaat cgcttgaatg gattggtcag atcaatccgaataatggagg aatcttcttt181aatcagaagt ttaaaggaaa agcgacgctt acagtcgataagtcgtcgaa cacggcgttc241atggaagtac ggtcgcttac gtcggaagat acggcggtctattactgtgc gagggaggcg301attacgacgg tgggagcgat ggactattgg ggacaagggacgtcggtcac ggtatcgtcg Protein Sequence Defining the Ch01G06 Chimeric Heavy Chain Variable Region (SEQ ID NO:40) 1evllqqsgpe lvkpgasvki pckasgytft dynmd wvkqshgkslewig g inpnnggiff61nqkfkg katl tvdkssntaf mevrsltsed tavyycar eaittvgamdy w gqgtsvtvss Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-18 Heavy Chain Variable Region (SEQ ID NO:53) 1caagtgcaac ttgtgcagtc gggtgcggaa gtcaaaaagccgggagcgtc ggtgaaagta61tcgtgtaaag cgtcgggata tacgtttacg gactataacatggactgggt acgacaggca121ccggggaaat cgttggaatg gatcggacag attaatccgaacaatggggg aattttcttt181aatcagaaat tcaaaggacg ggcgacgttg acggtcgatacatcgacgaa tacggcgtat241atggaattga ggtcgcttcg ctcggacgat acggcggtctattactgcgc cagggaggcg301atcacgacgg taggggcgat ggattattgg ggacaggggacgcttgtgac ggtatcgtcg Protein Sequence Defining the Hu01G06 IGHV1-18 Heavy Chain Variable Region (SEQ ID NO:54) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmd wvrqapgkslewig g inpnnggiff61nqkfkg ratl tvdtstntay melrslrsdd tavyycar eaittvgamdy w gqgtlvtvss Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-69 Heavy Chain Variable Region (SEQ ID NO:55) 1caagtccagc ttgtccagtc gggagcggaa gtgaagaaaccggggtcgtc ggtcaaagta61tcgtgtaaag cgtcgggata tacgtttacg gactataacatggattgggt acgacaggct121ccgggaaaat cattggaatg gattggacag attaatccgaataatggggg tatcttcttt181aatcaaaagt ttaaagggag ggcgacgttg acggtggacaaatcgacaaa tacggcgtat241atggaattgt cgtcgcttcg gtcggaggac acggcggtgtattactgcgc gagggaggcg301atcacgacgg tcggggcgat ggattattgg ggacagggaacgcttgtgac ggtatcgtcg Protein Sequence Defining the Hu01G06 IGHV1-69 Heavy Chain Variable Region (SEQ ID NO:56) 1qvqlvqsgae vkkpgssvkv sckasgytft dynmd wvrqapgkslewig g inpnnggiff61nqkfkg ratl tvdkstntay melsslrsed tavyycar eaittvgamdy w gqgtlvtvss Nucleic Acid Sequence Encoding the Sh01G06 IGHV1-18 M69L Heavy Chain Variable Region (SEQ ID NO:57) 1caggtccagc ttgtgcaatc gggagcggaa gtgaagaaaccgggagcgtc ggtaaaagtc61tcgtgcaaag cgtcggggta tacgtttacg gactataacatggactgggt gcgccaagcg121cctggacagg gtcttgaatg gatggggcag attaatccgaataatggagg gatcttcttt181aatcagaaat tcaaaggaag ggtaacgctg acgacagacacgtcaacatc gacggcctat241atggaattgc ggtcgttgcg atcagatgat acggcggtctactattgtgc gagggaggcg301attacgacgg tgggagcgat ggattattgg ggacaggggacgttggtaac ggtatcgtcg Protein Sequence Defining the Sh01G06 IGHV1-18 M69L Heavy Chain Variable Region (SEQ ID NO:58) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmd wvrqapgqglewmg g inpnnggiff61nqkfkg rvtl ttdtststay melrslrsdd tavyycar eaittvgamdy w gqgtlvtvss Nucleic Acid Sequence Encoding the Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain Variable Region (SEQ ID NO:59) 1caggtccagc ttgtgcaatc gggagcggaa gtgaagaaaccgggagcgtc ggtaaaagtc61tcgtgcaaag cgtcggggta tacgtttacg gactataacatggactgggt gcgccaagcg121cctggacaga gccttgaatg gatggggcag attaatccgaataatggagg gatcttcttt181aatcagaaat tccagggaag ggtaacgctg acgacagacacgtcaacatc gacggcctat241atggaattgc ggtcgttgcg atcagatgat acggcggtctactattgtgc gagggaggcg301attacgacgg tgggagcgat ggattattgg ggacaggggacgttggtaac ggtatcgtcg Protein Sequence Defining the Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain Variable Region (SEQ ID NO:60) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmd wvrqapgqslewmg g inpnnggiff61nqkfqg rvtl ttdtststay melrslrsdd tavyycar eaittvgamdy w gqgtlvtvss Nucleic Acid Sequence Encoding the Sh01G06 IGHV1-18 M69L K64Q Heavy Chain Variable Region (SEQ ID NO:61) 1caggtccagc ttgtgcaatc gggagcggaa gtgaagaaaccgggagcgtc ggtaaaagtc61tcgtgcaaag cgtcggggta tacgtttacg gactataacatggactgggt gcgccaagcg121cctggacagg gtcttgaatg gatggggcag attaatccgaataatggagg gatcttcttt181aatcagaaat tccagggaag ggtaacgctg acgacagacacgtcaacatc gacggcctat241atggaattgc ggtcgttgcg atcagatgat acggcggtctactattgtgc gagggaggcg301attacgacgg tgggagcgat ggattattgg ggacaggggacgttggtaac ggtatcgtcg Protein Sequence Defining the Sh01G06 IGHV1-18 M69L K64Q Heavy Chain Variable Region (SEQ ID NO:62) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmd wvrqapgqglewmg g inpnnggiff61nqkfqg rvtl ttdtststay melrslrsdd tavyycar eaittvgamdy w gqgtlvtvss Nucleic Acid Sequence Encoding the Sh01G06 IGHV1-69 T30S I69L Heavy Chain Variable Region (SEQ ID NO:63) 1caagtacagc ttgtacagtc gggagcggaa gtcaagaaaccgggatcgtc ggtcaaagtg61tcgtgtaaag cgtcgggata tacgtttagc gactataacatggattgggt gcgacaagcg121cctgggcagg gacttgaatg gatgggtcag atcaatccgaataatggggg aatctttttc181aatcagaagt ttaaagggag ggtaacgctg acggcggataaaagcacgtc aacggcgtat241atggagttgt cgtcgttgcg gtcggaggac acggcggtctattactgcgc gagggaagcg301attacgacgg tgggagcgat ggattattgg gggcagggaacgcttgtaac ggtgtcatcg Protein Sequence Defining the Sh01G06 IGHV1-69 T30S I69L Heavy Chain Variable Region (SEQ ID NO:64) 1qvqlvqsgae vkkpgssvkv sckasgytfs dynmd wvrqapgqglewmg q inpnnggiff61nqkfkg rvtl tadkststay melsslrsed tavyycar eaittvgamdy w gqgtlvtvss Nucleic Acid Sequence Encoding the Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain Variable Region (SEQ ID NO:65) 1caagtacagc ttgtacagtc gggagcggaa gtcaagaaaccgggatcgtc ggtcaaagtg61tcgtgtaaag cgtcgggata tacgtttagc gactataacatggattgggt gcgacaagcg121cctgggcagg gacttgaatg gatgggtcag atcaatccgaataatggggg aatctttttc181aatcagaagt ttcaggggag ggtaacgctg acggcggataaaagcacgtc aacggcgtat241atggagttgt cgtcgttgcg gtcggaggac acggcggtctattactgcgc gagggaagcg301attacgacgg tgggagcgat ggattattgg gggcagggaacgcttgtaac ggtgtcatcg Protein Sequence Defining the Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain Variable Region (SEQ ID NO:66) 1qvqlvqsgae vkkpgssvkv sckasgytfs dynmd wvrqapgqglewmg q inpnnggiff61ngkfqg rvtl tadkststay melsslrsed tavyycar eaittvgamdy w gqgtlvtvss Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-18 F1 Heavy Chain Variable Region (SEQ ID NO:245) 1caggtccagc ttgtgcaatc gggagcggaa gtgaagaaaccgggagcgtc ggtaaaagtc61tcgtgcaaag cgtcggggta tacgtttacg gactataacatggactgggt gcgccaagcg121cctggacaga gccttgaatg gatggggcag attaatccgtacaatcacct gatcttcttt181aatcagaaat tccagggaag ggtaacgctg acgacagacacgtcaacatc gacggcctat241atggaattgc ggtcgttgcg atcagatgat acggcggtctactattgtgc gagggaggcg301attacgacgg tgggagcgat ggattattgg ggacaggggacgttggtaac ggtatcgtcg Protein Sequence Defining the Hu01G06 IGHV1-18 F1 Heavy Chain Variable Region (SEQ ID NO:246) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmd wvrqapgqslewmg q inpynhliff61nqkfqg rvtl ttdtststay melrslrsdd tavyycar eaittvgamdy w gqgtlvtvss Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-18 F2 Heavy Chain Variable Region (SEQ ID NO:247) 1caggtccagc ttgtgcaatc gggagcggaa gtgaagaaaccgggagcgtc ggtaaaagtc61tcgtgcaaag cgtcggggta tacgtttacg gactataacatggactgggt gcgccaagcg121cctggacaga gccttgaatg gatggggcag attaatccgaataatggact gatcttcttt181aatcagaaat tccagggaag ggtaacgctg acgacagacacgtcaacatc gacggcctat241atggaattgc ggtcgttgcg atcagatgat acggcggtctactattgtgc gagggaggcg301attacgacgg tgggagcgat ggattattgg ggacaggggacgttggtaac ggtatcgtcg Protein Sequence Defining the Hu01G06 IGHV1-18 F2 Heavy Chain Variable Region (SEQ ID NO:248) 1qvglvqsgae vkkpgasvkv sckasgytft dynmd wvrqapgqslewmg q inpnngliff61nqkfqg rvtl ttdtststay melrslrsdd tavyycar eaittvgamdy w gqgtlvtvss Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-69 F1 Heavy Chain Variable Region (SEQ ID NO:249) 1caagtacagc ttgtacagtc gggagcggaa gtcaagaaaccgggatcgtc ggtcaaagtg61tcgtgtaaag cgtcgggata tacgtttagc gactataacatggattgggt gcgacaagcg121cctgggcagg gacttgaatg gatgggtcag atcaatccgaataatgggct gatctttttc181aatcagaagt ttaaagggag ggtaacgctg acggcggataaaagcacgtc aacggcgtat241atggagttgt cgtcgttgcg gtcggaggac acggcggtctattactgcgc gagggaagcg301attacgacgg tgggagcgat ggattattgg gggcagggaacgcttgtaac ggtgtcatcg Protein Sequence Defining the Hu01G06 IGHV1-69 F1 Heavy Chain Variable Region (SEQ ID NO:250) 1qvqlvqsgae vkkpgssvkv sckasgytfs dynmd wvrqapgqglewmg q inpnngliff61nqkfkg rvtl tadkststay melsslrsed tavyycar eaittvgamdy w gqgtlvtvss Nucleic Acid Sequence Encoding the Hu01G06 IGHV1-69 F2 Heavy Chain Variable Region (SEQ ID NO:251) 1caagtacagc ttgtacagtc gggagcggaa gtcaagaaaccgggatcgtc ggtcaaagtg61tcgtgtaaag cgtcgggata tacgtttagc gactataacatggattgggt gcgacaagcg121cctgggcagg gacttgaatg gatgggtcag atcaatccgtacaatcacct gatctttttc181aatcagaagt ttaaagggag ggtaacgctg acggcggataaaagcacgtc aacggcgtat241atggagttgt cgtcgttgcg gtcggaggac acggcggtctattactgcgc gagggaagcg301attacgacgg tgggagcgat ggattattgg gggcagggaacgcttgtaac ggtgtcatcg Protein Sequence Defining the Hu01G06 IGHV1-69 F2 Heavy Chain Variable Region (SEQ ID NO:252) 1qvqlvqsgae vkkpgssvkv sckasgytfs dynmd wvrqapgqglewmg q inpynhliff61nqkfkg rvtl tadkststay melsslrsed tavyycar eaittvgamdyw gqgtlvtvss Nucleic Acid Sequence Encoding the Ch06C11 Chimeric Heavy Chain Variable Region (SEQ ID NO:129) 1caggtgacac tcaaagaatc aggacccgga atccttcagcccagccagac cttgtcgctg61acttgttcgt tctccggttt cagcctgaat acttatgggatgggtgtgtc atggatcagg121caaccgtccg ggaaaggatt ggagtggctc gcgcacatctactgggacga tgacaaacgc181tacaatcctt cgctgaagag ccgattgacg atttccaaggatgcctcgaa caaccgggta241tttcttaaga tcacgtcggt cgatacggca gacacggcgacctattactg cgcccaaaga301gggtacgatg actattgggg atattggggc caggggacactcgtcacaat ttcagct Protein Sequence Defining the Ch06C11 Chimeric Heavy Chain Variable Region (SEQ ID NO:46) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsln tygmgvs wirqpsgkglewl a hiywdddkr61ynpslks rlt iskdasnnrv flkitsvdta dtatyycaq rgyddywgy wg qgtlvtisa Nucleic Acid Sequence Encoding the HE LM 06C11 IGHV2-70 Heavy Chain Variable Region (SEQ ID NO:67) 1caggtgactt tgaaagaatc cggtcccgca ttggtaaagccaacccagac acttacgctc61acatgtacat tttccggatt cagcttgaac acttacgggatgggagtgtc gtggattcgg121caacctccgg ggaaggctct ggagtggctg gcgcacatctactgggatga tgacaaaagg181tataacccct cacttaaaac gagactgacg atctcgaaggacacaagcaa gaatcaggtc241gtcctcacga ttacgaatgt agacccggtg gatactgccgtctattactg cgcgcaacgc301gggtatgatg actactgggg atattggggt cagggcaccctcgtgaccat ctcgtca Protein Sequence Defining the HE LM 06C11 IGHV2-70 Heavy Chain Variable Region (SEQ ID NO:68) 1qvtlkesgpa lvkptqtltl tctfsgfsln tygmgvs wirqppgkalewl a hiywdddkr61ynpslkt rlt iskdtsknqv vltitnvdpv dtavyycaq rgyddywgy wg qgtivtiss Nucleic Acid Sequence Encoding the Hu06C11 IGHV2-5 Heavy Chain Variable Region (SEQ ID NO:69) 1caagtaacgc tcaaggagtc cggacccacc ttggtgaagccgacgcagac cttgactctt61acgtgcactt tctcggggtt ttcactgaat acgtacgggatgggtgtctc atggatcagg121caacctccgg ggaaaggatt ggaatggctg gcgcacatctactgggatga cgataagaga181tataacccaa gcctcaagtc gcggctcacc attacaaaagatacatcgaa aaatcaggtc241gtacttacta tcacgaacat ggaccccgtg gacacagcaacatattactg tgcccagcgc301ggctatgacg attattgggg ttactgggga cagggaacactggtcacggt gtccagc Protein Sequence Defining the Hu06C11 IGHV2-5 Heavy Chain Variable Region (SEQ ID NO:70) 1qvtlkesgpt lvkptqtltl tctfsgfsln tygmgvs wirqppgkglewl a hiywdddkr61ynpslks rlt itkdtsknqv vltitnmdpv dtatyycaqrgyddywgy wg qgtlvtvss Nucleic Acid Sequence Encoding the Ch14F11 Chimeric Heavy Chain Variable Region (SEQ ID NO:131) 1caggtcacgc tgaaagagtc aggtcccgga atccttcaaccttcgcagac attgtcactc61acatgttcct tctccgggtt ctcgctctcg acttatggcatgggtgtagg atggattcgg121cagcccagcg ggaaggggct tgagtggttg gcggatatctggtgggacga cgacaaatac181tacaatccga gcctgaagtc ccgcctcacc atttcgaaagatacgtcatc aaacgaagtc241tttttgaaga tcgccatcgt ggacacggcg gatacagcgacgtattactg cgccagaagg301ggacactaca gcgcaatgga ttattgggga caggggacctcggtgactgt gtcgtcc Protein Sequence Defining the Ch14F11 Chimeric Heavy Chain Variable Region (SEQ ID NO:50) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsls tygmgvg wirqpsgkglewl a diwwdddky61ynpslks rlt iskdtssnev flkiaivdta dtatyycar rghysamdy wg qgtsvtvss Nucleic Acid Sequence Encoding the Sh14F11 IGHV2-5 Heavy Chain Variable Region (SEQ ID NO:71) 1cagatcactt tgaaagaaag cggaccgacc ttggtcaagcccacacaaac cctcacgctc61acgtgtacat tttcggggtt ctcgctttca acttacgggatgggagtagg gtggattcgc121cagccgcctg gtaaagcgtt ggagtggctt gcagacatctggtgggacga cgataagtac181tataatccct cgctcaagtc cagactgacc atcacgaaagatacgagcaa gaaccaggtc241gtgctgacaa tgactaacat ggacccagtg gatacggctacatattactg cgccaggcgg301ggtcactact cagcgatgga ttattggggc cagggaacactggtaacggt gtcgtcc Protein Sequence Defining the Sh14F11 IGHV2-5 Heavy Chain Variable Region (SEQ ID NO:72) 1qitlkesgpt lvkptqtltl tctfsgfsls tygmgvg wirqppgkalewl a diwwdddky61ynpslks rlt itkdtsknqv vltmtnmdpv dtatyycar rghysamdy wg qgtlvtvss Nucleic Acid Sequence Encoding the Sh14F11 IGHV2-70 Heavy Chain Variable Region (SEQ ID NO:73) 1caagtgactc tcaaggagtc cggacccgcc ctggtcaaaccaacgcagac actgacgctc61acatgcacct tcagcggatt ttcgttgtca acgtacggcatgggtgtggg gtggattcgc121cagcctccgg ggaaagccct tgaatggttg gcggacatctggtgggatga tgacaagtac181tataatccct cacttaagtc acggttgacg atctcgaaagacaccagcaa gaaccaggta241gtgctgacaa tgactaacat ggacccggtc gatacagcggtctactattg tgctagaagg301ggacactact ccgcaatgga ttattggggt caggggacgctcgtaaccgt gtcgtcg Protein Sequence Defining the Sh14F11 IGHV2-70 Heavy Chain Variable Region (SEQ ID NO:74) 1qvtlkesgpa lvkptqtltl tctfsgfsls tygmgvg wirqppgkalewl a diwwdddky61ynpslks rlt iskdtsknqv vltmtnmdpv dtavyycar rghysamdy wg qgtlvtvss Nucleic Acid Sequence Encoding the Ch01G06 Chimeric Kappa Chain Variable Region (SEQ ID NO:133) 1gacatccaaa tgacccagtc acccgcgagc ctttcggcgtcggtcggaga aacggtcacg61atcacgtgcc ggacatcaga gaatctccat aactacctcgcgtggtatca acagaagcag121gggaagtcgc cccagttgct tgtatacgat gcgaaaacgttggcggatgg ggtgccgtcc181agattctcgg gatcgggctc ggggacgcag tactcgctcaagatcaattc gctgcagccg241gaggactttg ggtcgtacta ttgtcagcat ttttggtcatcaccgtatac atttggaggt301ggaacgaaac ttgagattaa g Protein Sequence Defining the Ch01G06 Chimeric Kappa Chain Variable Region (SEQ ID NO:76) 1diqmtqspas lsasvgetvt itc rtsenlh nyla wyqqkqgkspqllvy d aktlad gvps61rfsgsgsgtq yslkinslqp edfgsyyc qh fwsspyt fgggtkleik Nucleic Acid Sequence Encoding the Hu01G06 IGKV1-39 Kappa Chain Variable Region (SEQ ID NO:89) 1gacatccaaa tgacccagtc gccgtcgtcg ctttcagcgtcggtagggga tcgggtcaca61attacgtgcc gaacgtcaga gaatttgcat aactacctcgcgtggtatca gcagaagccc121gggaagtcac cgaaactcct tgtctacgat gcgaaaacgctggcggatgg agtgccgtcg181agattctcgg gaagcggatc cggtacggac tatacgcttacgatctcatc gctccagccc241gaggactttg cgacgtacta ttgtcagcat ttttggtcgtcgccctacac atttgggcag301gggaccaagt tggaaatcaa g Protein Sequence Defining the Hu01G06 IGKV1-39 Kappa Chain Variable Region (SEQ ID NO:90) 1diqmtqspss lsasvgdrvt itc rtsenlh nyla wyqqkpgkspkllvy d aktlad gvps61rfsgsgsgtd ytltisslqp edfatyyc qh fwsspyt fgqgtkleik Nucleic Acid Sequence Encoding the Hu01G06 IGKV1-39 S43A V48I Kappa Chain Variable Region (also referred to herein as Hu01G06 IGKV1-39 F1 Kappa Chain Variable Region; SEQ ID NO:91) 1gacatccaaa tgacccagtc gccgtcgtcg ctttcagcgtcggtagggga tcgggtcaca61attacgtgcc gaacgtcaga gaatttgcat aactacctcgcgtggtatca gcagaagccc121gggaaggccc cgaaactcct tatctacgat gcgaaaacgctggcggatgg agtgccgtcg181agattctcgg gaagcggatc cggtacggac tatacgcttacgatctcatc gctccagccc241gaggactttg cgacgtacta ttgtcagcat ttttggtcgtcgccctacac atttgggcag301gggaccaagt tggaaatcaa g Protein Sequence Defining the Hu01G06 IGKV1-39 S43A V48I Kappa Chain Variable Region (also referred to herein as Hu01G06 IGKV1-39 F1 Kappa Chain Variable Region; SEQ ID NO:92) 1diqmtqspss lsasvgdrvt itc rtsenlh nyla wyqqkpgkapklliy d aktlad gvps61rfsgsgsgtd ytltisslqp edfatyyc qh fwsspyt fgqgtkleik Nucleic Acid Sequence Encoding the Hu01G06 IGKV1-39 V48I Kappa Chain Variable Region (SEQ ID NO:93) 1gacatccaaa tgacccagtc gccgtcgtcg ctttcagcgtcggtagggga tcgggtcaca61attacgtgcc gaacgtcaga gaatttgcat aactacctcgcgtggtatca gcagaagccc121gggaagtcac cgaaactcct tatctacgat gcgaaaacgctggcggatgg agtgccgtcg181agattctcgg gaagcggatc cggtacggac tatacgcttacgatctcatc gctccagccc241gaggactttg cgacgtacta ttgtcagcat ttttggtcgtcgccctacac atttgggcag301gggaccaagt tggaaatcaa g Protein Sequence Defining the Hu01G06 IGKV1-39 V48I Kappa Chain Variable Region (SEQ ID NO:94) 1diqmtqspss lsasvgdrvt itc rtsenlh nyla wyqqkpgkspklliy d aktlad gvps61rfsgsgsgtd ytltisslqp edfatyyc qh fwsspyt fgqgtkleik Nucleic Acid Sequence Encoding the Hu01G06 IGKV1-39 F1 Kappa Chain Variable Region (also referred to herein as Hu01G06 IGKV1-39 S43A V48I Kappa Chain Variable Region; SEQ ID NO:91) 1gacatccaaa tgacccagtc gccgtcgtcg ctttcagcgtcggtagggga tcgggtcaca61attacgtgcc gaacgtcaga gaatttgcat aactacctcgcgtggtatca gcagaagccc121gggaaggccc cgaaactcct tatctacgat gcgaaaacgctggcggatgg agtgccgtcg181agattctcgg gaagcggatc cggtacggac tatacgcttacgatctcatc gctccagccc241gaggactttg cgacgtacta ttgtcagcat ttttggtcgtcgccctacac atttgggcag301gggaccaagt tggaaatcaa g Protein Sequence Defining the Hu01G06 IGKV1-39 F1 Kappa Chain Variable Region (also referred to herein as Hu01G06 IGKV1-39 S43A V48I Kappa Chain Variable Region; SEQ ID NO:92) 1diqmtqspss lsasvgdrvt itc rtsenlh nyla wyqqkpgkapklliy d aktlad gvps61rfsgsgsgtd ytltisslqp edfatyyc qh fwsspyt fgqgtkleik Nucleic Acid Sequence Encoding the Hu01G06 IGKV1-39 F2 Kappa Chain Variable Region (SEQ ID NO:253) 1gacatccaaa tgacccagtc gccgtcgtcg ctttcagcgtcggtagggga tcgggtcaca61attacgtgcc gaacgtcaga gaatttgcat aactacctcgcgtggtatca gcagaagccc121gggaagtcac cgaaactcct tatctacgat gcgaaaacgctggcggatgg agtgccgtcg181agattctcgg gaagcggatc cggtacggac tatacgcttacgatctcatc gctccagccc241gaggactttg cgacgtacta ttgtcagcat ttttggtcggacccctacac atttgggcag301gggaccaagt tggaaatcaa g Protein Sequence Defining the Hu01G06 IGKV1-39 F2 Kappa Chain Variable Region (SEQ ID NO:254) 1diqmtqspss lsasvgdrvt itc rtsenlh nyla wyqqkpgkspklliy d aktlad gvps61rfsgsgsgtd ytltisslqp edfatyyc qh fwsdpyt fgqgtkleik Nucleic Acid Sequence Encoding the Ch06C11 Chimeric Kappa Chain Variable Region (SEQ ID NO:135) 1gatatcgtca tgacccagtc ccagaagttc atgtcaacttcagtgggaga cagagtgtcc61gtcacatgta aagcctcgca aaatgtggga accaacgtagcgtggttcca gcagaaacct121ggccaatcac cgaaggcact gatctactcg gccagctataggtactcggg agtaccagat181cggtttacgg ggtcggggag cgggacggac tttatcctcactatttccaa tgtccagtcg241gaggaccttg cggaatactt ctgccagcag tataacaactatcccctcac gtttggtgct301ggtacaaaat tggagttgaa g Protein Sequence Defining the Ch06C11 Chimeric Kappa Chain Variable Region (SEQ ID NO:82) 1divmtqsqkf mstsvgdrvs vtc kasqnvg tnva wfqqkpgqspkaliy s asyrys gvpd61rftgsgsgtd filtisnvqs edlaeyfc qq ynnvplt fgagtklelk Nucleic Acid Sequence Encoding the Sh06C11 IGKV1-16 Kappa Chain Variable Region (SEQ ID NO:95) 1gacatccaaa tgacccaatc gccctcctcc ctctccgcatcagtagggga ccgcgtcaca61attacttgca aagcgtcgca gaacgtcgga acgaatgtggcgtggtttca gcagaagccc121ggaaaagctc cgaagagctt gatctactcg gcctcatataggtattcggg tgtgccgagc181cggtttagcg ggtcggggtc aggtactgat ttcacgctcacaatttcatc gttgcagcca241gaagatttcg ccacatatta ctgtcagcag tacaacaattaccctctgac gttcggccag301ggaaccaaac ttgagatcaa g Protein Sequence Defining the Sh06C11 IGKV1-16 Kappa Chain Variable Region (SEQ ID NO:96) 1diqmtqspss lsasvgdrvt itc kasqnvg tnva wfqqkpgkapksliy s asyrys gvps61rfsgsgsgtd ftltisslqp edfatyyc qq ynnyplt fgqgtkleik Nucleic Acid Sequence Encoding the Ch14F11 Chimeric Kappa Chain Variable Region (SEQ ID NO:137) 1gacatcgtga tgacacagtc acagaaattc atgtccacatccgtcggtga tagagtatcc61gtcacgtgta aggcctcgca aaacgtagga actaatgtggcgtggtatca acagaagcca121ggacagtcac ccaaagcact catctacagc ccctcatatcggtacagcgg ggtgccggac181aggttcacgg gatcggggag cgggaccgat tttacactgaccatttcgaa tgtccagtcg241gaggaccttg cggaatactt ctgccagcag tataactcgtaccctcacac gtttggaggt301ggcactaagt tggagatgaa a Protein Sequence Defining the Ch14F11 Chimeric Kappa Chain Variable Region (SEQ ID NO:86) 1divmtqsqkf mstsvgdrvs vtc kasqnvg tnva wyqqkpgqspkaliy s psyrys gvpd61rftgsgsgtd ftltisnvqs edlaeyfc qq ynsvpht fgggtklemk Nucleic Acid Sequence Encoding the Hu14F11 IGKV1-16 Kappa Chain Variable Region (SEQ ID NO:97) 1gatatccaga tgacacagtc accctcgtcg ctctcagcttccgtaggcga cagggtcact61attacgtgta aagcatcaca gaacgtcgga acgaatgtggcgtggtttca gcagaagccc121gggaagagcc ccaaagcgct tatctactcc ccgtcgtatcggtattccgg tgtgccaagc181agattttcgg ggtcaggttc gggaactgac tttaccctgaccatctcgtc cctccaaccg241gaagatttcg ccacgtactt ctgccagcag tacaacagctatcctcacac attcggacaa301gggacaaagt tggagattaa a Protein Sequence Defining the Hu14F11 IGKV1-16 Kappa Chain Variable Region (SEQ ID NO:98) 1diqmtqspss lsasvgdrvt itc kasqnvg tnva wfqqkpgkspkaliy s psyrys gvps61rfsgsgsgtd ftltisslqp edfatyfc qq ynsypht fgqgtkleik The amino acid sequences defining the immunoglobulin heavy chain variable regions for the antibodies produced in Example 13 are aligned in FIG. 19 . Amino terminal signal peptide sequences (for proper expression/secretion) are not shown. CDR 1 , CDR 2 , and CDR 3 (Kabat definition) are identified by boxes. FIG. 20 show an alignment of the separate CDR 1 , CDR 2 , and CDR 3 sequences for each of the variable region sequences shown in FIG. 19 . The amino acid sequences defining the immunoglobulin light chain variable regions for the antibodies in Example 13 are aligned in FIG. 21 . Amino terminal signal peptide sequences (for proper expression/secretion) are not shown. CDR 1 , CDR 2 and CDR 3 are identified by boxes. FIG. 22 shows an alignment of the separate CDR 1 , CDR 2 , and CDR 3 sequences for each of the variable region sequences shown in FIG. 21 . Table 19 is a concordance chart showing the SEQ ID NO. of each sequence discussed in this Example. TABLE 19SEQ. ID NO.Nucleic Acid or Protein127Ch01G06 Chimeric Heavy Chain Variable Region-nucleic acid40Ch01G06 Chimeric Heavy Chain Variable Region-protein1Ch01G06 Chimeric Heavy Chain CDR 17Ch01G06 Chimeric Heavy Chain CDR 215Ch01G06 Chimeric Heavy Chain CDR 353Hu01G06 IGHV1-18 Heavy Chain Variable Region-nucleic acid54Hu01G06 IGHV1-18 Heavy Chain Variable Region-protein1Hu01G06 IGHV1-18 Heavy Chain CDR 17Hu01G06 IGHV1-18 Heavy Chain CDR 215Hu01G06 IGHV1-18 Heavy Chain CDR 355Hu01G06 IGHV1-69 Heavy Chain Variable Region-nucleic acid56Hu01G06 IGHV1-69 Heavy Chain Variable Region-protein1Hu01G06 IGHV1-69 Heavy Chain CDR 17Hu01G06 IGHV1-69 Heavy Chain CDR 215Hu01G06 IGHV1-69 Heavy Chain CDR 357Sh01G06 IGHV1-18 M69L Heavy Chain Variable Region-nucleic acid58Sh01G06 IGHV1-18 M69L Heavy Chain Variable Region-protein1Sh01G06 IGHV1-18 M69L Heavy Chain CDR 17Sh01G06 IGHV1-18 M69L Heavy Chain CDR 215Sh01G06 IGHV1-18 M69L Heavy Chain CDR 359Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain Variable Region-nucleic acid60Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain Variable Region-protein1Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain CDR 113Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain CDR 215Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain CDR 361Sh01G06 IGHV1-18 M69L K64Q Heavy Chain Variable Region-nucleic acid62Sh01G06 IGHV1-18 M69L K64Q Heavy Chain Variable Region-protein1Sh01G06 IGHV1-18 M69L K64Q Heavy Chain CDR 113Sh01G06 IGHV1-18 M69L K64Q Heavy Chain CDR 215Sh01G06 IGHV1-18 M69L K64Q Heavy Chain CDR 363Sh01G06 IGHV1-69 T30S I69L Heavy Chain Variable Region-nucleic acid64Sh01G06 IGHV1-69 T30S I69L Heavy Chain Variable Region-protein1Sh01G06 IGHV1-69 T30S I69L Heavy Chain CDR 17Sh01G06 IGHV1-69 T30S I69L Heavy Chain CDR 215Sh01G06 IGHV1-69 T30S I69L Heavy Chain CDR 365Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain Variable Region-nucleic acid66Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain Variable Region-protein1Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain CDR 113Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain CDR 215Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain CDR 3245Hu01G06 IGHV1-18 F1 Heavy Chain Variable Region-nucleic acid246Hu01G06 IGHV1-18 F1 Heavy Chain Variable Region-protein1Hu01G06 IGHV1-18 F1 Heavy Chain CDR 1236Hu01G06 IGHV1-18 F1 Heavy Chain CDR 215Hu01G06 IGHV1-18 F1 Heavy Chain CDR 3247Hu01G06 IGHV1-18 F2 Heavy Chain Variable Region-nucleic acid248Hu01G06 IGHV1-18 F2 Heavy Chain Variable Region-protein1Hu01G06 IGHV1-18 F2 Heavy Chain CDR 1237Hu01G06 IGHV1-18 F2 Heavy Chain CDR 215Hu01G06 IGHV1-18 F2 Heavy Chain CDR 3259Hu01G06 IGHV1-69 F1 Heavy Chain Variable Region-nucleic acid250Hu01G06 IGHV1-69 F1 Heavy Chain Variable Region-protein1Hu01G06 IGHV1-69 F1 Heavy Chain CDR 1238Hu01G06 IGHV1-69 F1 Heavy Chain CDR 215Hu01G06 IGHV1-69 F1 Heavy Chain CDR 3251Hu01G06 IGHV1-69 F2 Heavy Chain Variable Region-nucleic acid252Hu01G06 IGHV1-69 F2 Heavy Chain Variable Region-protein1Hu01G06 IGHV1-69 F2 Heavy Chain CDR 1239Hu01G06 IGHV1-69 F2 Heavy Chain CDR 215Hu01G06 IGHV1-69 F2 Heavy Chain CDR 3129Ch06C11 Chimeric Heavy Chain Variable Region-nucleic acid46Ch06C11 Chimeric Heavy Chain Variable Region-protein4Ch06C11 Chimeric Heavy Chain CDR 19Ch06C11 Chimeric Heavy Chain CDR 218Ch06C11 Chimeric Heavy Chain CDR 367HE LM 06C11 IGHV2-70 Heavy Chain Variable Region-nucleic acid68HE LM 06C11 IGHV2-70 Heavy Chain Variable Region-protein4HE LM 06C11 IGHV2-70 Heavy Chain CDR 114HE LM 06C11 IGHV2-70 Heavy Chain CDR 218HE LM 06C11 IGHV2-70 Heavy Chain CDR 369Hu06C11 IGHV2-5 Heavy Chain Variable Region-nucleic acid70Hu06C11 IGHV2-5 Heavy Chain Variable Region-protein4Hu06C11 IGHV2-5 Heavy Chain CDR 19Hu06C11 IGHV2-5 Heavy Chain CDR 218Hu06C11 IGHV2-5 Heavy Chain CDR 3131Ch14F11 Chimeric Heavy Chain Variable Region-nucleic acid50Ch14F11 Chimeric Heavy Chain Variable Region-protein5Ch14F11 Chimeric Heavy Chain CDR 111Ch14F11 Chimeric Heavy Chain CDR 219Ch14F11 Chimeric Heavy Chain CDR 371Sh14F11 IGHV2-5 Heavy Chain Variable Region-nucleic acid72Sh14F11 IGHV2-5 Heavy Chain Variable Region-protein5Sh14F11 IGHV2-5 Heavy Chain CDR 111Sh14F11 IGHV2-5 Heavy Chain CDR 219Sh14F11 IGHV2-5 Heavy Chain CDR 373Sh14F11 IGHV2-70 Heavy Chain Variable Region-nucleic acid74Sh14F11 IGHV2-70 Heavy Chain Variable Region-protein5Sh14F11 IGHV2-70 Heavy Chain CDR 111Sh14F11 IGHV2-70 Heavy Chain CDR 219Sh14F11 IGHV2-70 Heavy Chain CDR 3133Ch01G06 Chimeric Light (kappa) Chain Variable Region-nucleic acid76Ch01G06 Chimeric Light (kappa) Chain Variable Region-protein21Ch01G06 Chimeric Light (kappa) Chain CDR 126Ch01G06 Chimeric Light (kappa) Chain CDR 232Ch01G06 Chimeric Light (kappa) Chain CDR 389Hu01G06 IGKV1-39 Light (kappa) Chain Variable Region-nucleic acid90Hu01G06 IGKV1-39 Light (kappa) Chain Variable Region-protein21Hu01G06 IGKV1-39 Light (kappa) Chain CDR 126Hu01G06 IGKV1-39 Light (kappa) Chain CDR 232Hu01G06 IGKV1-39 Light (kappa) Chain CDR 391Hu01G06 IGKV1-39 S43A V48I Light (kappa) Chain Variable Region-nucleic acid92Hu01G06 IGKV1-39 S43A V48I Light (kappa) Chain Variable Region-protein21Hu01G06 IGKV1-39 S43A V48I Light (kappa) Chain CDR 126Hu01G06 IGKV1-39 S43A V48I Light (kappa) Chain CDR 232Hu01G06 IGKV1-39 S43A V48I Light (kappa) Chain CDR 393Hu01G06 IGKV1-39 V48I Light (kappa) Chain Variable Region-nucleic acid94Hu01G06 IGKV1-39 V48I Light (kappa) Chain Variable Region-protein21Hu01G06 IGKV1-39 V48I Light (kappa) Chain CDR 126Hu01G06 IGKV1-39 V48I Light (kappa) Chain CDR 232Hu01G06 IGKV1-39 V48I Light (kappa) Chain CDR 391Hu01G06 IGKV1-39 F1 Light (kappa) Chain Variable Region-nucleic acid92Hu01G06 IGKV1-39 F1 Light (kappa) Chain Variable Region-protein21Hu01G06 IGKV1-39 F1 Light (kappa) Chain CDR 126Hu01G06 IGKV1-39 F1 Light (kappa) Chain CDR 232Hu01G06 IGKV1-39 F1 Light (kappa) Chain CDR 3253Hu01G06 IGKV1-39 F2 Light (kappa) Chain Variable Region-nucleic acid254Hu01G06 IGKV1-39 F2 Light (kappa) Chain Variable Region-protein21Hu01G06 IGKV1-39 F2 Light (kappa) Chain CDR 126Hu01G06 IGKV1-39 F2 Light (kappa) Chain CDR 2244Hu01G06 IGKV1-39 F2 Light (kappa) Chain CDR 3135Ch06C11 Chimeric Light (kappa) Chain Variable Region-nucleic acid82Ch06C11 Chimeric Light (kappa) Chain Variable Region-protein23Ch06C11 Chimeric Light (kappa) Chain CDR 128Ch06C11 Chimeric Light (kappa) Chain CDR 235Ch06C11 Chimeric Light (kappa) Chain CDR 395Sh06C11 IGKV1-16 Light (kappa) Chain Variable Region-nucleic acid96Sh06C11 IGKV1-16 Light (kappa) Chain Variable Region-protein23Sh06C11 IGKV1-16 Light (kappa) Chain CDR 128Sh06C11 IGKV1-16 Light (kappa) Chain CDR 235Sh06C11 IGKV1-16 Light (kappa) Chain CDR 3137Ch14F11 Chimeric Light (kappa) Chain Variable Region-nucleic acid86Ch14F11 Chimeric Light (kappa) Chain Variable Region-protein23Ch14F11 Chimeric Light (kappa) Chain CDR 130Ch14F11 Chimeric Light (kappa) Chain CDR 236Ch14F11 Chimeric Light (kappa) Chain CDR 397Hu14F11 IGKV1-16 Light (kappa) Chain Variable Region-nucleic acid98Hu14F11 IGKV1-16 Light (kappa) Chain Variable Region-protein23Hu14F11 IGKV1-16 Light (kappa) Chain CDR 130Hu14F11 IGKV1-16 Light (kappa) Chain CDR 236Hu14F11 IGKV1-16 Light (kappa) Chain CDR 3 Humanized monoclonal antibody heavy chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 20. TABLE 20Variable RegionCDR1CDR2CDR3SEQ ID NO:KabatCh01G06 ChimericDYNMDQINPNNGGIFFNQKFKGEAITTVGAMDY40(SEQ ID NO: 1)(SEQ ID NO: 7)(SEQ ID NO: 15)Hu01G06 IGHV1-DYNMDQINPNNGGIFFNQKFKGEAITTVGAMDY5418(SEQ ID NO: 1)(SEQ ID NO: 7)(SEQ ID NO: 15)Hu01G06 IGHV1-DYNMDQINPNNGGIFFNQKFKGEAITTVGAMDY5669(SEQ ID NO: 1)(SEQ ID NO: 7)(SEQ ID NO: 15)Sh01G06 IGHV1-DYNMDQINPNNGGIFFNQKFKGEAITTVGAMDY5818 M69L(SEQ ID NO: 1)(SEQ ID NO: 7)(SEQ ID NO: 15)Sh01G06 IGHV1-DYNMDQINPNNGGIFFNQKFQGEAITTVGAMDY6018 M69L K64Q(SEQ ID NO: 1)(SEQ ID NO: 13)(SEQ ID NO: 15)G44SSh01G06 IGHV1-DYNMDQINPNNGGIFFNQKFQGEAITTVGAMDY6218 M69L K64Q(SEQ ID NO: 1)(SEQ ID NO: 13)(SEQ ID NO: 15)Sh01G06 IGHV1-DYNMDQINPNNGGIFFNQKFKGEAITTVGAMDY6469 T30S I69L(SEQ ID NO: 1)(SEQ ID NO: 7)(SEQ ID NO: 15)Sh01G06 IGHV1-DYNMDQINPNNGGIFFNQKFQGEAITTVGAMDY6669 T30S K64Q(SEQ ID NO: 1)(SEQ ID NO: 13)(SEQ ID NO: 15)I69LHu01G06 IGHV1-DYNMDQINPYNHLIFFNQKFQGEAITTVGAMDY24618 F1(SEQ ID NO: 1)(SEQ ID NO: 236)(SEQ ID NO: 15)Hu01G06 IGHV1-DYNMDQINPNNGLIFFNQKFQGEAITTVGAMDY24818 F2(SEQ ID NO: 1)(SEQ ID NO: 237)(SEQ ID NO: 15)Hu01G06 IGHV1-DYNMDQINPNNGLIFFNQKFKGEAITTVGAMDY25069 F1(SEQ ID NO: 1)(SEQ ID NO: 238)(SEQ ID NO: 15)Hu01G06 IGHV1-DYNMDQINPYNHLIFFNQKFKGEAITTVGAMDY25269 F2(SEQ ID NO: 1)(SEQ ID NO: 239)(SEQ ID NO: 15)Ch06C11 ChimericTYGMGVSHIYWDDDKRYNPSLKSRGYDDYWGY46(SEQ ID NO: 4)(SEQ ID NO: 9)(SEQ ID NO: 18)HE LM 06C11TYGMGVSHIYWDDDKRYNPSLKTRGYDDYWGY68IGHV2-70(SEQ ID NO: 4)(SEQ ID NO: 14)(SEQ ID NO: 18)Hu06C11 IGHV2-5TYGMGVSHIYWDDDKRYNPSLKSRGYDDYWGY70(SEQ ID NO: 4)(SEQ ID NO: 9)(SEQ ID NO: 18)Ch14F11 ChimericTYGMGVGDIWWDDDKYYNPSLKSRGHYSAMDY50(SEQ ID NO: 5)(SEQ ID NO: 11)(SEQ ID NO: 19)Sh14F11 IGHV2-5TYGMGVGDIWWDDDKYYNPSLKSRGHYSAMDY72(SEQ ID NO: 5)(SEQ ID NO: 11)(SEQ ID NO: 19)Sh14F11 IGHV2-TYGMGVGDIWWDDDKYYNPSLKSRGHYSAMDY7470(SEQ ID NO: 5)(SEQ ID NO: 11)(SEQ ID NO: 19)ChothiaCh01G06GYTFTDYNPNNGGEAITTVGAMDY40Chimeric(SEQ ID NO: 38)(SEQ ID NO: 143)(SEQ ID NO: 15)Hu01G06 IGHV1-GYTFTDYNPNNGGEAITTVGAMDY5418(SEQ ID NO: 38)(SEQ ID NO: 143)(SEQ ID NO: 15)Hu01G06 IGHV1-GYTFTDYNPNNGGEAITTVGAMDY5669(SEQ ID NO: 38)(SEQ ID NO: 143)(SEQ ID NO: 15)Sh01G06 IGHV1-GYTFTDYNPNNGGEAITTVGAMDY5818 M69L(SEQ ID NO: 38)(SEQ ID NO: 143)(SEQ ID NO: 15)Sh01G06 IGHV1-GYTFTDYNPNNGGEAITTVGAMDY6018 M69L K64Q(SEQ ID NO: 38)(SEQ ID NO: 143)(SEQ ID NO: 15)G44SSh01G06 IGHV1-GYTFTDYNPNNGGEAITTVGAMDY6218 M69L K64Q(SEQ ID NO: 38)(SEQ ID NO: 143)(SEQ ID NO: 15)Sh01G06 IGHV1-GYTFSDYNPNNGGEAITTVGAMDY6469 T30S I69L(SEQ ID NO: 234)(SEQ ID NO: 143)(SEQ ID NO: 15)Sh01G06 IGHV1-GYTFSDYNPNNGGEAITTVGAMDY6669 T30S K64Q(SEQ ID NO: 234)(SEQ ID NO: 143)(SEQ ID NO: 15)I69LHu01G06 IGHV1-GYTFTDYNPYNHLEAITTVGAMDY24618 F1(SEQ ID NO: 38)(SEQ ID NO: 240)(SEQ ID NO: 15)Hu01G06 IGHV1-GYTFTDYNPNNGLEAITTVGAMDY24818 F2(SEQ ID NO: 38)(SEQ ID NO: 241)(SEQ ID NO: 15)Hu01G06 IGHV1-GYTFSDYNPNNGLEAITTVGAMDY25069 F1(SEQ ID NO: 234)(SEQ ID NO: 241)(SEQ ID NO: 15)Hu01G06 IGHV1-GYTFSDYNPYNHLEAITTVGAMDY25269 F2(SEQ ID NO: 234)(SEQ ID NO: 240)(SEQ ID NO: 15)Ch06C11GFSLNTYGMYWDDDRGYDDYWGY46Chimeric(SEQ ID NO: 132)(SEQ ID NO: 145)(SEQ ID NO: 18)HE LM 06C11GFSLNTYGMYWDDDRGYDDYWGY68IGHV2-70(SEQ ID NO: 132)(SEQ ID NO: 145)(SEQ ID NO: 18)Hu06C11 IGHV2-5GFSLNTYGMYWDDDRGYDDYWGY70(SEQ ID NO: 132)(SEQ ID NO: 145)(SEQ ID NO: 18)Ch14F11 ChimericGFSLSTYGMWWDDDRGHYSAMDY50(SEQ ID NO: 130)(SEQ ID NO: 146)(SEQ ID NO: 19)Sh14F11 IGHV2-5GFSLSTYGMWWDDDRGHYSAMDY72(SEQ ID NO: 130)(SEQ ID NO: 146)(SEQ ID NO: 19)Sh14F11 IGHV2-GFSLSTYGMWWDDDRGHYSAMDY7470(SEQ ID NO: 130)(SEQ ID NO: 146)(SEQ ID NO: 19)IMGTCh01G06GYTFTDYNINPNNGGIAREAITTVGAMDY40Chimeric(SEQ ID NO: 136)(SEQ ID NO: 148)(SEQ ID NO: 154)Hu01G06GYTFTDYNINPNNGGIAREAITTVGAMDY54IGHV1-18(SEQ ID NO: 136)(SEQ ID NO: 148)(SEQ ID NO: 154)Hu01G06GYTFTDYNINPNNGGIAREAITTVGAMDY56IGHV1-69(SEQ ID NO: 136)(SEQ ID NO: 148)(SEQ ID NO: 154)Sh01G06GYTFTDYNINPNNGGIAREAITTVGAMDY58IGHV1-18 M69L(SEQ ID NO: 136)(SEQ ID NO: 148)(SEQ ID NO: 154)Sh01G06GYTFTDYNINPNNGGIAREAITTVGAMDY60IGHV1-18 M69L(SEQ ID NO: 136)(SEQ ID NO: 148)(SEQ ID NO: 154)K64Q G44SSh01G06GYTFTDYNINPNNGGIAREAITTVGAMDY62IGHV1-18 M69L(SEQ ID NO: 136)(SEQ ID NO: 148)(SEQ ID NO: 154)K64QSh01G06GYTFSDYNINPNNGGIAREAITTVGAMDY64IGHV1-69 T30S(SEQ ID NO: 235)(SEQ ID NO: 148)(SEQ ID NO: 154)I69LSh01G06GYTFSDYNINPNNGGIAREAITTVGAMDY66IGHV1-69 T30S(SEQ ID NO: 235)(SEQ ID NO: 148)(SEQ ID NO: 154)K64Q I69LHu01G06GYTFTDYNINPYNHLIAREAITTVGAMDY246IGHV1-18 F1(SEQ ID NO: 136)(SEQ ID NO: 242)(SEQ ID NO: 154)Hu01G06GYTFTDYNINPNNGLIAREAITTVGAMDY248IGHV1-18 F2(SEQ ID NO: 136)(SEQ ID NO: 243)(SEQ ID NO: 154)Hu01G06GYTFSDYNINPNNGLIAREAITTVGAMDY250IGHV1-69 F1(SEQ ID NO: 235)(SEQ ID NO: 243)(SEQ ID NO: 154)Hu01G06GYTFSDYNINPYNHLIAREAITTVGAMDY252IGHV1-69 F2(SEQ ID NO: 235)(SEQ ID NO: 242)(SEQ ID NO: 154)Ch06C11GFSLNTYGMGIYWDDDKAQRGYDDYWGY46Chimeric(SEQ ID NO: 141)(SEQ ID NO: 150)(SEQ ID NO: 157)HE LM 06C11GFSLNTYGMGIYWDDDKAQRGYDDYWGY68IGHV2-70(SEQ ID NO: 141)(SEQ ID NO: 150)(SEQ ID NO: 157)Hu06C11GFSLNTYGMGIYWDDDKAQRGYDDYWGY70IGHV2-5(SEQ ID NO: 141)(SEQ ID NO: 150)(SEQ ID NO: 157)Ch14F11GFSLSTYGMGIWWDDDKARRGHYSAMDY50Chimeric(SEQ ID NO: 140)(SEQ ID NO: 152)(SEQ ID NO: 158)Sh14F11 IGHV2-5GFSLSTYGMGIWWDDDKARRGHYSAMDY72(SEQ ID NO: 140)(SEQ ID NO: 152)(SEQ ID NO: 158)Sh14F11 IGHV2-GFSLSTYGMGIWWDDDKARRGHYSAMDY7470(SEQ ID NO: 140)(SEQ ID NO: 152)(SEQ ID NO: 158) Humanized monoclonal antibody Kappa light chain CDR sequences (Kabat, Chothia, and IMGT definitions) are shown in Table 21. TABLE 21Variable RegionCDR1CDR2CDR3SEQ ID NO:Kabat/ChothiaCh01G06 ChimericRTSENLHNYLADAKTLADQHFWSSPYT76(SEQ ID NO: 21)(SEQ ID NO: 26)(SEQ ID NO: 32)Hu01G06 IGKV1-39RTSENLHNYLADAKTLADQHFWSSPYT90(SEQ ID NO: 21)(SEQ ID NO: 26)(SEQ ID NO: 32)Hu01G06 IGKV1-39RTSENLHNYLADAKTLADQHFWSSPYT92S43A V48I (also(SEQ ID NO: 21)(SEQ ID NO: 26)(SEQ ID NO: 32)known as Hu01G06IGKV1-39 F1)Hu01G06 IGKV1-39RTSENLHNYLADAKTLADQHFWSSPYT94V48I(SEQ ID NO: 21)(SEQ ID NO: 26)(SEQ ID NO: 32)Hu01G06 IGKV1-39RTSENLHNYLADAKTLADQHFWSSPYT92F1 (also known as(SEQ ID NO: 21)(SEQ ID NO: 26)(SEQ ID NO: 32)Hu01G06 IGKV1-39S43A V48I)Hu01G06 IGKV1-39RTSENLHNYLADAKTLADQHFWSDPYT254F2(SEQ ID NO: 21)(SEQ ID NO: 26)(SEQ ID NO: 244)Ch06C11 ChimericKASQNVGTNVASASYRYSQQYNNYPLT82(SEQ ID NO: 23)(SEQ ID NO: 28)(SEQ ID NO: 35)Sh06C11 IGKV1-16KASQNVGTNVASASYRYSQQYNNYPLT96(SEQ ID NO: 23)(SEQ ID NO: 28)(SEQ ID NO: 35)Ch14F11 ChimericKASQNVGTNVASPSYRYSQQYNSYPHT86(SEQ ID NO: 23)(SEQ ID NO: 30)(SEQ ID NO: 36)Hu14F11 IGKV1-16KASQNVGTNVASPSYRYSQQYNSYPHT98(SEQ ID NO: 23)(SEQ ID NO: 30)(SEQ ID NO: 36)IMGTCh01G06 ChimericENLHNYDAKQHFWSSPYT76(SEQ ID NO: 160)(SEQ ID NO: 32)Hu01G06 IGKV1-39ENLHNYDAKQHFWSSPYT90(SEQ ID NO: 160)(SEQ ID NO: 32)Hu01G06 IGKV1-39ENLHNYDAKQHFWSSPYT92S43A V48I (also(SEQ ID NO: 160)(SEQ ID NO: 32)known as Hu01G06IGKV1-39 F1)Hu01G06 IGKV1-39ENLHNYDAKQHFWSSPYT94V48I(SEQ ID NO: 160)(SEQ ID NO: 32)Hu01G06 IGKV1-39ENLHNYDAKQHFWSSPYT92F1 (also known as(SEQ ID NO: 160)(SEQ ID NO: 32)Hu01G06 IGKV1-39S43A V48I)Hu01G06 IGKV1-39ENLHNYDAKQHFWSDPYT254F2(SEQ ID NO: 160)(SEQ ID NO: 244)Ch06C11 ChimericQNVGTNSASQQYNNYPLT82(SEQ ID NO: 162)(SEQ ID NO: 35)Sh06C11 IGKV1-16QNVGTNSASQQYNNYPLT96(SEQ ID NO: 162)(SEQ ID NO: 35)Ch14F11 ChimericQNVGTNSPSQQYNSYPHT86(SEQ ID NO: 162)(SEQ ID NO: 36)Hu14F11 IGKV1-16QNVGTNSPSQQYNSYPHT98(SEQ ID NO: 162)(SEQ ID NO: 36) To create the complete chimeric and humanized heavy or kappa chain antibody sequences, each variable sequence above is combined with its respective human constant region. For example, a complete heavy chain comprises a heavy variable sequence followed by a human IgG1 heavy chain constant sequence. A complete kappa chain comprises a kappa variable sequence followed by the human kappa light chain constant sequence. Nucleic Acid Sequence Encoding the Human IgG1 Heavy Chain Constant Region (SEQ ID NO:171) 1gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg61ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc121tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct181ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc241tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc301aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt361cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc421gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg481tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat541agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa601gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt661aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa721atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc781gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg841ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg901cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc961cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Human IgG1 Heavy Chain Constant Region (SEQ ID NO:172) 1astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss61glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg121psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn181styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree241mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw301qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Human Kappa Light Chain Constant Region (SEQ ID NO:173) 1cgcacagttg ctgcccccag cgtgttcatt ttcccacctagcgatgagca gctgaaaagc61ggtactgcct ctgtcgtatg cttgctcaac aacttttacccacgtgaggc taaggtgcag121tggaaagtgg ataatgcact tcaatctgga aacagtcaagagtccgtgac agaacaggac181agcaaagact caacttattc actctcttcc accctgactctgtccaaggc agactatgaa241aaacacaagg tatacgcctg cgaggttaca caccagggtttgtctagtcc tgtcaccaag301tccttcaata ggggcgaatg t Protein Sequence Defining the Human Kappa Light Chain Constant Region (SEQ ID NO:174) 1rtvaapsvfi fppsdeqlks gtasvvclln nfypreakvqwkvdnalqsg nsqesvteqd61skdstyslss tltlskadye khkvyacevt hqglsspvtksfnrgec The following sequences represent the actual or contemplated full length heavy and light chain sequence (i.e., containing both the variable and constant regions sequences) for each antibody described in this Example. Signal sequences for proper secretion of the antibodies (e.g., signal sequences at the 5′ end of the DNA sequences or the amino terminal end of the protein sequences) are not shown in the full length heavy and light chain sequences disclosed herein and are not included in the final secreted protein. Also not shown are stop codons for termination of translation required at the 3′ end of the DNA sequences. It is within ordinary skill in the art to select a signal sequence and/or a stop codon for expression of the disclosed full length immunoglobulin heavy chain and light chain sequences. It is also contemplated that the variable region sequences can be ligated to other constant region sequences to produce active full length immunoglobulin heavy and light chains. Nucleic Acid Sequence Encoding the Full Length Ch01G06 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:175) 1gaagtgttgt tgcagcagtc agggccggag ttggtaaaaccgggagcgtc ggtgaaaatc61ccgtgcaaag cgtcggggta tacgtttacg gactataacatggattgggt gaaacagtcg121catgggaaat cgcttgaatg gattggtcag atcaatccgaataatggagg aatcttcttt181aatcagaagt ttaaaggaaa agcgacgctt acagtcgataagtcgtcgaa cacggcgttc241atggaagtac ggtcgcttac gtcggaagat acggcggtctattactgtgc gagggaggcg301attacgacgg tgggagcgat ggactattgg ggacaagggacgtcggtcac ggtatcgtcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Ch01G06 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:176) 1evllqqsgpe lvkpgasvki pckasgytft dynmdwvkqshgkslewigq inpnnggiff61nqkfkgkatl tvdkssntaf mevrsltsed tavyycareaittvgamdyw gqgtsvtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-18 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:177) 1caagtgcaac ttgtgcagtc gggtgcggaa gtcaaaaagccgggagcgtc ggtgaaagta61tcgtgtaaag cgtcgggata tacgtttacg gactataacatggactgggt acgacaggca121ccggggaaat cgttggaatg gatcggacag attaatccgaacaatggggg aattttcttt181aatcagaaat tcaaaggacg ggcgacgttg acggtcgatacatcgacgaa tacggcgtat241atggaattga ggtcgcttcg ctcggacgat acggcggtctattactgcgc cagggaggcg301atcacgacgg taggggcgat ggattattgg ggacaggggacgcttgtgac ggtatcgtcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Hu01G06 IGHV1-18 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:178) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmdwvrqapgkslewigq inpnnggiff61nqkfkgratl tvdtstntay melrslrsdd tavyycareaittvgamdyw gqgtivtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-69 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:179) 1caagtccagc ttgtccagtc gggagcggaa gtgaagaaaccggggtcgtc ggtcaaagta61tcgtgtaaag cgtcgggata tacgtttacg gactataacatggattgggt acgacaggct121ccgggaaaat cattggaatg gattggacag attaatccgaataatggggg tatcttcttt181aatcaaaagt ttaaagggag ggcgacgttg acggtggacaaatcgacaaa tacggcgtat241atggaattgt cgtcgcttcg gtcggaggac acggcggtgtattactgcgc gagggaggcg301atcacgacgg tcggggcgat ggattattgg ggacagggaacgcttgtgac ggtatcgtcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Hu01G06 IGHV1-69 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:180) 1qvqlvqsgae vkkpgssvkv sckasgytft dynmdwvrqapgkslewigq inpnnggiff61nqkfkgratl tvdkstntay melsslrsed tavyycareaittvgamdyw gqgtivtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Sh01G06 IGHV1-18 M69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:181) 1caggtccagc ttgtgcaatc gggagcggaa gtgaagaaaccgggagcgtc ggtaaaagtc61tcgtgcaaag cgtcggggta tacgtttacg gactataacatggactgggt gcgccaagcg121cctggacagg gtcttgaatg gatggggcag attaatccgaataatggagg gatcttcttt181aatcagaaat tcaaaggaag ggtaacgctg acgacagacacgtcaacatc gacggcctat241atggaattgc ggtcgttgcg atcagatgat acggcggtctactattgtgc gagggaggcg301attacgacgg tgggagcgat ggattattgg ggacaggggacgttggtaac ggtatcgtcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Sh01G06 IGHV1-18 M69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:182) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmdwvrqapgqglewmgq inpnnggiff61nqkfkgrvtl ttdtststay melrslrsdd tavyycareaittvgamdyw gqgtivtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:183) 1caggtccagc ttgtgcaatc gggagcggaa gtgaagaaaccgggagcgtc ggtaaaagtc61tcgtgcaaag cgtcggggta tacgtttacg gactataacatggactgggt gcgccaagcg121cctggacaga gccttgaatg gatggggcag attaatccgaataatggagg gatcttcttt181aatcagaaat tccagggaag ggtaacgctg acgacagacacgtcaacatc gacggcctat241atggaattgc ggtcgttgcg atcagatgat acggcggtctactattgtgc gagggaggcg301attacgacgg tgggagcgat ggattattgg ggacaggggacgttggtaac ggtatcgtcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:184) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmdwvrqapgqslewmgq inpnnggiff61nqkfqgrvtl ttdtststay melrslrsdd tavyycareaittvgamdyw gqgtivtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Sh01G06 IGHV1-18 M69L K64Q Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:185) 1caggtccagc ttgtgcaatc gggagcggaa gtgaagaaaccgggagcgtc ggtaaaagtc61tcgtgcaaag cgtcggggta tacgtttacg gactataacatggactgggt gcgccaagcg121cctggacagg gtcttgaatg gatggggcag attaatccgaataatggagg gatcttcttt181aatcagaaat tccagggaag ggtaacgctg acgacagacacgtcaacatc gacggcctat241atggaattgc ggtcgttgcg atcagatgat acggcggtctactattgtgc gagggaggcg301attacgacgg tgggagcgat ggattattgg ggacaggggacgttggtaac ggtatcgtcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Sh01G06 IGHV1-18 M69L K64Q Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:186) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmdwvrqapgqglewmgq inpnnggiff61nqkfqgrvtl ttdtststay melrslrsdd tavyycareaittvgamdyw gqgtlvtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Sh01G06 IGHV1-69 T30S I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:187) 1caagtacagc ttgtacagtc gggagcggaa gtcaagaaaccgggatcgtc ggtcaaagtg61tcgtgtaaag cgtcgggata tacgtttagc gactataacatggattgggt gcgacaagcg121cctgggcagg gacttgaatg gatgggtcag atcaatccgaataatggggg aatctttttc181aatcagaagt ttaaagggag ggtaacgctg acggcggataaaagcacgtc aacggcgtat241atggagttgt cgtcgttgcg gtcggaggac acggcggtctattactgcgc gagggaagcg301attacgacgg tgggagcgat ggattattgg gggcagggaacgcttgtaac ggtgtcatcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Sh01G06 IGHV1-69 T30S I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:188) 1qvqlvqsgae vkkpgssvkv sckasgytfs dynmdwvrqapgqglewmgq inpnnggiff61nqkfkgrvtl tadkststay melsslrsed tavyycareaittvgamdyw gqgtlvtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:189) 1caagtacagc ttgtacagtc gggagcggaa gtcaagaaaccgggatcgtc ggtcaaagtg61tcgtgtaaag cgtcgggata tacgtttagc gactataacatggattgggt gcgacaagcg121cctgggcagg gacttgaatg gatgggtcag atcaatccgaataatggggg aatctttttc181aatcagaagt ttcaggggag ggtaacgctg acggcggataaaagcacgtc aacggcgtat241atggagttgt cgtcgttgcg gtcggaggac acggcggtctattactgcgc gagggaagcg301attacgacgg tgggagcgat ggattattgg gggcagggaacgcttgtaac ggtgtcatcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:190) 1qvqlvqsgae vkkpgssvkv sckasgytfs dynmdwvrqapgqglewmgq inpnnggiff61nqkfqgrvtl tadkststay melsslrsed tavyycareaittvgamdyw gqgtlvtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-18 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:255) 1caggtccagc ttgtgcaatc gggagcggaa gtgaagaaaccgggagcgtc ggtaaaagtc61tcgtgcaaag cgtcggggta tacgtttacg gactataacatggactgggt gcgccaagcg121cctggacaga gccttgaatg gatggggcag attaatccgtacaatcacct gatcttcttt181aatcagaaat tccagggaag ggtaacgctg acgacagacacgtcaacatc gacggcctat241atggaattgc ggtcgttgcg atcagatgat acggcggtctactattgtgc gagggaggcg301attacgacgg tgggagcgat ggattattgg ggacaggggacgttggtaac ggtatcgtcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Hu01G06 IGHV1-18 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:256) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmdwvrqapgqslewmgq inpynhliff61nqkfqgrvtl ttdtststay melrslrsdd tavyycareaittvgamdyw gqgtlvtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-18 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:257) 1caggtccagc ttgtgcaatc gggagcggaa gtgaagaaaccgggagcgtc ggtaaaagtc61tcgtgcaaag cgtcggggta tacgtttacg gactataacatggactgggt gcgccaagcg121cctggacaga gccttgaatg gatggggcag attaatccgaataatggact gatcttcttt181aatcagaaat tccagggaag ggtaacgctg acgacagacacgtcaacatc gacggcctat241atggaattgc ggtcgttgcg atcagatgat acggcggtctactattgtgc gagggaggcg301attacgacgg tgggagcgat ggattattgg ggacaggggacgttggtaac ggtatcgtcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Hu01G06 IGHV1-18 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:258) 1qvqlvqsgae vkkpgasvkv sckasgytft dynmdwvrqapgqslewmgq inpnngliff61nqkfqgrvtl ttdtststay melrslrsdd tavyycareaittvgamdyw gqgtlvtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-69 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:259) 1caagtacagc ttgtacagtc gggagcggaa gtcaagaaaccgggatcgtc ggtcaaagtg61tcgtgtaaag cgtcgggata tacgtttagc gactataacatggattgggt gcgacaagcg121cctgggcagg gacttgaatg gatgggtcag atcaatccgaataatgggct gatctttttc181aatcagaagt ttaaagggag ggtaacgctg acggcggataaaagcacgtc aacggcgtat241atggagttgt cgtcgttgcg gtcggaggac acggcggtctattactgcgc gagggaagcg301attacgacgg tgggagcgat ggattattgg gggcagggaacgcttgtaac ggtgtcatcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Hu01G06 IGHV1-69 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:260) 1qvqlvqsgae vkkpgssvkv sckasgytfs dynmdwvrqapgqglewmgq inpnngliff61nqkfkgrvtl tadkststay melsslrsed tavyycareaittvgamdyw gqgtivtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGHV1-69 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:261) 1caagtacagc ttgtacagtc gggagcggaa gtcaagaaaccgggatcgtc ggtcaaagtg61tcgtgtaaag cgtcgggata tacgtttagc gactataacatggattgggt gcgacaagcg121cctgggcagg gacttgaatg gatgggtcag atcaatccgtacaatcacct gatctttttc181aatcagaagt ttaaagggag ggtaacgctg acggcggataaaagcacgtc aacggcgtat241atggagttgt cgtcgttgcg gtcggaggac acggcggtctattactgcgc gagggaagcg301attacgacgg tgggagcgat ggattattgg gggcagggaacgcttgtaac ggtgtcatcg361gcctcaacaa aaggaccaag tgtgttccca ctcgcccctagcagcaagag tacatccggg421ggcactgcag cactcggctg cctcgtcaag gattattttccagagccagt aaccgtgagc481tggaacagtg gagcactcac ttctggtgtc catacttttcctgctgtcct gcaaagctct541ggcctgtact cactcagctc cgtcgtgacc gtgccatcttcatctctggg cactcagacc601tacatctgta atgtaaacca caagcctagc aatactaaggtcgataagcg ggtggaaccc661aagagctgcg acaagactca cacttgtccc ccatgccctgcccctgaact tctgggcggt721cccagcgtct ttttgttccc accaaagcct aaagatactctgatgataag tagaacaccc781gaggtgacat gtgttgttgt agacgtttcc cacgaggacccagaggttaa gttcaactgg841tacgttgatg gagtcgaagt acataatgct aagaccaagcctagagagga gcagtataat901agtacatacc gtgtagtcag tgttctcaca gtgctgcaccaagactggct caacggcaaa961gaatacaaat gcaaagtgtc caacaaagca ctcccagcccctatcgagaa gactattagt1021aaggcaaagg ggcagcctcg tgaaccacag gtgtacactctgccacccag tagagaggaa1081atgacaaaga accaagtctc attgacctgc ctggtgaaaggcttctaccc cagcgacatc1141gccgttgagt gggagagtaa cggtcagcct gagaacaattacaagacaac ccccccagtg1201ctggatagtg acgggtcttt ctttctgtac agtaagctgactgtggacaa gtcccgctgg1261cagcagggta acgtcttcag ctgttccgtg atgcacgaggcattgcacaa ccactacacc1321cagaagtcac tgagcctgag cccagggaag Protein Sequence Defining the Full Length Hu01G06 IGHV1-69 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:262) 1qvqlvqsgae vkkpgssvkv sckasgytfs dynmdwvrqapgqglewmgq inpynhliff61nqkfkgrvtl tadkststay melsslrsed tavyycareaittvgamdyw gqgtivtvss121astkgpsvfp lapsskstsg gtaalgclvk dyfpepvtvswnsgaltsgv htfpavlqss181glyslssvvt vpssslgtqt yicnvnhkps ntkvdkrvepkscdkthtcp pcpapellgg241psvflfppkp kdtlmisrtp evtcvvvdvs hedpevkfnwyvdgvevhna ktkpreeqyn301styrvvsvlt vlhqdwlngk eykckvsnka lpapiektiskakgqprepq vytlppsree361mtknqvsltc lvkgfypsdi avewesngqp ennykttppvldsdgsffly skltvdksrw421qqgnvfscsv mhealhnhyt qkslslspgk Nucleic Acid Sequence Encoding the Full Length Ch06C11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:191) 1caggtgacac tcaaagaatc aggacccgga atccttcagcccagccagac cttgtcgctg61acttgttcgt tctccggttt cagcctgaat acttatgggatgggtgtgtc atggatcagg121caaccgtccg ggaaaggatt ggagtggctc gcgcacatctactgggacga tgacaaacgc181tacaatcctt cgctgaagag ccgattgacg atttccaaggatgcctcgaa caaccgggta241tttcttaaga tcacgtcggt cgatacggca gacacggcgacctattactg cgcccaaaga301gggtacgatg actattgggg atattggggc caggggacactcgtcacaat ttcagctgcc361tcaacaaaag gaccaagtgt gttcccactc gcccctagcagcaagagtac atccgggggc421actgcagcac tcggctgcct cgtcaaggat tattttccagagccagtaac cgtgagctgg481aacagtggag cactcacttc tggtgtccat acttttcctgctgtcctgca aagctctggc541ctgtactcac tcagctccgt cgtgaccgtg ccatcttcatctctgggcac tcagacctac601atctgtaatg taaaccacaa gcctagcaat actaaggtcgataagcgggt ggaacccaag661agctgcgaca agactcacac ttgtccccca tgccctgcccctgaacttct gggcggtccc721agcgtctttt tgttcccacc aaagcctaaa gatactctgatgataagtag aacacccgag781gtgacatgtg ttgttgtaga cgtttcccac gaggacccagaggttaagtt caactggtac841gttgatggag tcgaagtaca taatgctaag accaagcctagagaggagca gtataatagt901acataccgtg tagtcagtgt tctcacagtg ctgcaccaagactggctcaa cggcaaagaa961tacaaatgca aagtgtccaa caaagcactc ccagcccctatcgagaagac tattagtaag1021gcaaaggggc agcctcgtga accacaggtg tacactctgccacccagtag agaggaaatg1081acaaagaacc aagtctcatt gacctgcctg gtgaaaggcttctaccccag cgacatcgcc1141gttgagtggg agagtaacgg tcagcctgag aacaattacaagacaacccc cccagtgctg1201gatagtgacg ggtctttctt tctgtacagt aagctgactgtggacaagtc ccgctggcag1261cagggtaacg tcttcagctg ttccgtgatg cacgaggcattgcacaacca ctacacccag1321aagtcactga gcctgagccc agggaag Protein Sequence Defining the Full Length Ch06C11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:192) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsln tygmgvswirqpsgkglewl ahiywdddkr61ynpslksrlt iskdasnnrv flkitsvdta dtatyycaqrgyddywgywg qgtlvtisaa121stkgpsvfpl apsskstsgg taalgclvkd yfpepvtvswnsgaltsgvh tfpavlqssg181lyslssvvtv pssslgtqty icnvnhkpsn tkvdkrvepkscdkthtcpp cpapellggp241svflfppkpk dtlmisrtpe vtcvvvdvsh edpevkfnwyvdgvevhnak tkpreeqyns301tyrvvsvltv lhqdwlngke ykckvsnkal papiektiskakgqprepqv ytlppsreem361tknqvsltcl vkgfypsdia vewesngqpe nnykttppvldsdgsfflys kltvdksrwq421qgnvfscsvm healhnhytq kslslspgk Nucleic Acid Sequence Encoding the Full Length HE LM 06C11 IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:193) 1caggtgactt tgaaagaatc cggtcccgca ttggtaaagccaacccagac acttacgctc61acatgtacat tttccggatt cagcttgaac acttacgggatgggagtgtc gtggattcgg121caacctccgg ggaaggctct ggagtggctg gcgcacatctactgggatga tgacaaaagg181tataacccct cacttaaaac gagactgacg atctcgaaggacacaagcaa gaatcaggtc241gtcctcacga ttacgaatgt agacccggtg gatactgccgtctattactg cgcgcaacgc301gggtatgatg actactgggg atattggggt cagggcaccctcgtgaccat ctcgtcagcc361tcaacaaaag gaccaagtgt gttcccactc gcccctagcagcaagagtac atccgggggc421actgcagcac tcggctgcct cgtcaaggat tattttccagagccagtaac cgtgagctgg481aacagtggag cactcacttc tggtgtccat acttttcctgctgtcctgca aagctctggc541ctgtactcac tcagctccgt cgtgaccgtg ccatcttcatctctgggcac tcagacctac601atctgtaatg taaaccacaa gcctagcaat actaaggtcgataagcgggt ggaacccaag661agctgcgaca agactcacac ttgtccccca tgccctgcccctgaacttct gggcggtccc721agcgtctttt tgttcccacc aaagcctaaa gatactctgatgataagtag aacacccgag781gtgacatgtg ttgttgtaga cgtttcccac gaggacccagaggttaagtt caactggtac841gttgatggag tcgaagtaca taatgctaag accaagcctagagaggagca gtataatagt901acataccgtg tagtcagtgt tctcacagtg ctgcaccaagactggctcaa cggcaaagaa961tacaaatgca aagtgtccaa caaagcactc ccagcccctatcgagaagac tattagtaag1021gcaaaggggc agcctcgtga accacaggtg tacactctgccacccagtag agaggaaatg1081acaaagaacc aagtctcatt gacctgcctg gtgaaaggcttctaccccag cgacatcgcc1141gttgagtggg agagtaacgg tcagcctgag aacaattacaagacaacccc cccagtgctg1201gatagtgacg ggtctttctt tctgtacagt aagctgactgtggacaagtc ccgctggcag1261cagggtaacg tcttcagctg ttccgtgatg cacgaggcattgcacaacca ctacacccag1321aagtcactga gcctgagccc agggaag Protein Sequence Defining the Full Length HE LM 06C11 IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:194) 1qvtlkesgpa lvkptqtltl tctfsgfsln tygmgvswirqppgkalewl ahiywdddkr61ynpslktrlt iskdtsknqv vltitnvdpv dtavyycaqrgyddywgywg qgtlvtissa121stkgpsvfpl apsskstsgg taalgclvkd yfpepvtvswnsgaltsgvh tfpavlqssg181lyslssvvtv pssslgtqty icnvnhkpsn tkvdkrvepkscdkthtcpp cpapellggp241svflfppkpk dtlmisrtpe vtcvvvdvsh edpevkfnwyvdgvevhnak tkpreeqyns301tyrvvsvltv lhqdwlngke ykckvsnkal papiektiskakgqprepqv ytlppsreem361tknqvsltcl vkgfypsdia vewesngqpe nnykttppvldsdgsfflys kltvdksrwq421qgnvfscsvm healhnhytq kslslspgk Nucleic Acid Sequence Encoding the Full Length Hu06C11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:195) 1caagtaacgc tcaaggagtc cggacccacc ttggtgaagccgacgcagac cttgactctt61acgtgcactt tctcggggtt ttcactgaat acgtacgggatgggtgtctc atggatcagg121caacctccgg ggaaaggatt ggaatggctg gcgcacatctactgggatga cgataagaga181tataacccaa gcctcaagtc gcggctcacc attacaaaagatacatcgaa aaatcaggtc241gtacttacta tcacgaacat ggaccccgtg gacacagcaacatattactg tgcccagcgc301ggctatgacg attattgggg ttactgggga cagggaacactggtcacggt gtccagcgcc361tcaacaaaag gaccaagtgt gttcccactc gcccctagcagcaagagtac atccgggggc421actgcagcac tcggctgcct cgtcaaggat tattttccagagccagtaac cgtgagctgg481aacagtggag cactcacttc tggtgtccat acttttcctgctgtcctgca aagctctggc541ctgtactcac tcagctccgt cgtgaccgtg ccatcttcatctctgggcac tcagacctac601atctgtaatg taaaccacaa gcctagcaat actaaggtcgataagcgggt ggaacccaag661agctgcgaca agactcacac ttgtccccca tgccctgcccctgaacttct gggcggtccc721agcgtctttt tgttcccacc aaagcctaaa gatactctgatgataagtag aacacccgag781gtgacatgtg ttgttgtaga cgtttcccac gaggacccagaggttaagtt caactggtac841gttgatggag tcgaagtaca taatgctaag accaagcctagagaggagca gtataatagt901acataccgtg tagtcagtgt tctcacagtg ctgcaccaagactggctcaa cggcaaagaa961tacaaatgca aagtgtccaa caaagcactc ccagcccctatcgagaagac tattagtaag1021gcaaaggggc agcctcgtga accacaggtg tacactctgccacccagtag agaggaaatg1081acaaagaacc aagtctcatt gacctgcctg gtgaaaggcttctaccccag cgacatcgcc1141gttgagtggg agagtaacgg tcagcctgag aacaattacaagacaacccc cccagtgctg1201gatagtgacg ggtctttctt tctgtacagt aagctgactgtggacaagtc ccgctggcag1261cagggtaacg tcttcagctg ttccgtgatg cacgaggcattgcacaacca ctacacccag1321aagtcactga gcctgagccc agggaag Protein Sequence Defining the Full Length Hu06C11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:196) 1qvtlkesgpt lvkptqtltl tctfsgfsln tygmgvswirqppgkglewl ahiywdddkr61ynpslksrlt itkdtsknqv vltitnmdpv dtatyycaqrgyddywgywg qgtlvtvssa121stkgpsvfpl apsskstsgg taalgclvkd yfpepvtvswnsgaltsgvh tfpavlqssg181lyslssvvtv pssslgtqty icnvnhkpsn tkvdkrvepkscdkthtcpp cpapellggp241svflfppkpk dtlmisrtpe vtcvvvdvsh edpevkfnwyvdgvevhnak tkpreeqyns301tyrvvsvltv lhqdwlngke ykckvsnkal papiektiskakgqprepqv ytlppsreem361tknqvsltcl vkgfypsdia vewesngqpe nnykttppvldsdgsfflys kltvdksrwq421qgnvfscsvm healhnhytq kslslspgk Nucleic Acid Sequence Encoding the Full Length Ch14F11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:197) 1caggtcacgc tgaaagagtc aggtcccgga atccttcaaccttcgcagac attgtcactc61acatgttcct tctccgggtt ctcgctctcg acttatggcatgggtgtagg atggattcgg121cagcccagcg ggaaggggct tgagtggttg gcggatatctggtgggacga cgacaaatac181tacaatccga gcctgaagtc ccgcctcacc atttcgaaagatacgtcatc aaacgaagtc241tttttgaaga tcgccatcgt ggacacggcg gatacagcgacgtattactg cgccagaagg301ggacactaca gcgcaatgga ttattgggga caggggacctcggtgactgt gtcgtccgcc361tcaacaaaag gaccaagtgt gttcccactc gcccctagcagcaagagtac atccgggggc421actgcagcac tcggctgcct cgtcaaggat tattttccagagccagtaac cgtgagctgg481aacagtggag cactcacttc tggtgtccat acttttcctgctgtcctgca aagctctggc541ctgtactcac tcagctccgt cgtgaccgtg ccatcttcatctctgggcac tcagacctac601atctgtaatg taaaccacaa gcctagcaat actaaggtcgataagcgggt ggaacccaag661agctgcgaca agactcacac ttgtccccca tgccctgcccctgaacttct gggcggtccc721agcgtctttt tgttcccacc aaagcctaaa gatactctgatgataagtag aacacccgag781gtgacatgtg ttgttgtaga cgtttcccac gaggacccagaggttaagtt caactggtac841gttgatggag tcgaagtaca taatgctaag accaagcctagagaggagca gtataatagt901acataccgtg tagtcagtgt tctcacagtg ctgcaccaagactggctcaa cggcaaagaa961tacaaatgca aagtgtccaa caaagcactc ccagcccctatcgagaagac tattagtaag1021gcaaaggggc agcctcgtga accacaggtg tacactctgccacccagtag agaggaaatg1081acaaagaacc aagtctcatt gacctgcctg gtgaaaggcttctaccccag cgacatcgcc1141gttgagtggg agagtaacgg tcagcctgag aacaattacaagacaacccc cccagtgctg1201gatagtgacg ggtctttctt tctgtacagt aagctgactgtggacaagtc ccgctggcag1261cagggtaacg tcttcagctg ttccgtgatg cacgaggcattgcacaacca ctacacccag1321aagtcactga gcctgagccc agggaag Protein Sequence Defining the Full Length Ch14F11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:198) 1qvtlkesgpg ilqpsqtlsl tcsfsgfsls tygmgvgwirqpsgkglewl adiwwdddky61ynpslksrlt iskdtssnev flkiaivdta dtatyycarrghysamdywg qgtsvtvssa121stkgpsvfpl apsskstsgg taalgclvkd yfpepvtvswnsgaltsgvh tfpavlqssg181lyslssvvtv pssslgtqty icnvnhkpsn tkvdkrvepkscdkthtcpp cpapellggp241svflfppkpk dtlmisrtpe vtcvvvdvsh edpevkfnwyvdgvevhnak tkpreeqyns301tyrvvsvltv lhqdwlngke ykckvsnkal papiektiskakgqprepqv ytlppsreem361tknqvsltcl vkgfypsdia vewesngqpe nnykttppvldsdgsfflys kltvdksrwq421qgnvfscsvm healhnhytq kslslspgk Nucleic Acid Sequence Encoding the Full Length Sh14F11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:199) 1cagatcactt tgaaagaaag cggaccgacc ttggtcaagcccacacaaac cctcacgctc61acgtgtacat tttcggggtt ctcgctttca acttacgggatgggagtagg gtggattcgc121cagccgcctg gtaaagcgtt ggagtggctt gcagacatctggtgggacga cgataagtac181tataatccct cgctcaagtc cagactgacc atcacgaaagatacgagcaa gaaccaggtc241gtgctgacaa tgactaacat ggacccagtg gatacggctacatattactg cgccaggcgg301ggtcactact cagcgatgga ttattggggc cagggaacactggtaacggt gtcgtccgcc361tcaacaaaag gaccaagtgt gttcccactc gcccctagcagcaagagtac atccgggggc421actgcagcac tcggctgcct cgtcaaggat tattttccagagccagtaac cgtgagctgg481aacagtggag cactcacttc tggtgtccat acttttcctgctgtcctgca aagctctggc541ctgtactcac tcagctccgt cgtgaccgtg ccatcttcatctctgggcac tcagacctac601atctgtaatg taaaccacaa gcctagcaat actaaggtcgataagcgggt ggaacccaag661agctgcgaca agactcacac ttgtccccca tgccctgcccctgaacttct gggcggtccc721agcgtctttt tgttcccacc aaagcctaaa gatactctgatgataagtag aacacccgag781gtgacatgtg ttgttgtaga cgtttcccac gaggacccagaggttaagtt caactggtac841gttgatggag tcgaagtaca taatgctaag accaagcctagagaggagca gtataatagt901acataccgtg tagtcagtgt tctcacagtg ctgcaccaagactggctcaa cggcaaagaa961tacaaatgca aagtgtccaa caaagcactc ccagcccctatcgagaagac tattagtaag1021gcaaaggggc agcctcgtga accacaggtg tacactctgccacccagtag agaggaaatg1081acaaagaacc aagtctcatt gacctgcctg gtgaaaggcttctaccccag cgacatcgcc1141gttgagtggg agagtaacgg tcagcctgag aacaattacaagacaacccc cccagtgctg1201gatagtgacg ggtctttctt tctgtacagt aagctgactgtggacaagtc ccgctggcag1261cagggtaacg tcttcagctg ttccgtgatg cacgaggcattgcacaacca ctacacccag1321aagtcactga gcctgagccc agggaag Protein Sequence Defining the Full Length Sh14F11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:200) 1qitlkesgpt lvkptqtltl tctfsgfsls tygmgvgwirqppgkalewl adiwwdddky61ynpslksrlt itkdtsknqv vltmtnmdpv dtatyycarrghysamdywg qgtlvtvssa121stkgpsvfpl apsskstsgg taalgclvkd yfpepvtvswnsgaltsgvh tfpavlqssg181lyslssvvtv pssslgtqty icnvnhkpsn tkvdkrvepkscdkthtcpp cpapellggp241svflfppkpk dtlmisrtpe vtcvvvdvsh edpevkfnwyvdgvevhnak tkpreeqyns301tyrvvsvltv lhqdwlngke ykckvsnkal papiektiskakgqprepqv ytlppsreem361tknqvsltcl vkgfypsdia vewesngqpe nnykttppvldsdgsfflys kltvdksrwq421qgnvfscsvm healhnhytq kslslspgk Nucleic Acid Sequence Encoding the Full Length Sh14F11 IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:201) 1caagtgactc tcaaggagtc cggacccgcc ctggtcaaaccaacgcagac actgacgctc61acatgcacct tcagcggatt ttcgttgtca acgtacggcatgggtgtggg gtggattcgc121cagcctccgg ggaaagccct tgaatggttg gcggacatctggtgggatga tgacaagtac181tataatccct cacttaagtc acggttgacg atctcgaaagacaccagcaa gaaccaggta241gtgctgacaa tgactaacat ggacccggtc gatacagcggtctactattg tgctagaagg301ggacactact ccgcaatgga ttattggggt caggggacgctcgtaaccgt gtcgtcggcc361tcaacaaaag gaccaagtgt gttcccactc gcccctagcagcaagagtac atccgggggc421actgcagcac tcggctgcct cgtcaaggat tattttccagagccagtaac cgtgagctgg481aacagtggag cactcacttc tggtgtccat acttttcctgctgtcctgca aagctctggc541ctgtactcac tcagctccgt cgtgaccgtg ccatcttcatctctgggcac tcagacctac601atctgtaatg taaaccacaa gcctagcaat actaaggtcgataagcgggt ggaacccaag661agctgcgaca agactcacac ttgtccccca tgccctgcccctgaacttct gggcggtccc721agcgtctttt tgttcccacc aaagcctaaa gatactctgatgataagtag aacacccgag781gtgacatgtg ttgttgtaga cgtttcccac gaggacccagaggttaagtt caactggtac841gttgatggag tcgaagtaca taatgctaag accaagcctagagaggagca gtataatagt901acataccgtg tagtcagtgt tctcacagtg ctgcaccaagactggctcaa cggcaaagaa961tacaaatgca aagtgtccaa caaagcactc ccagcccctatcgagaagac tattagtaag1021gcaaaggggc agcctcgtga accacaggtg tacactctgccacccagtag agaggaaatg1081acaaagaacc aagtctcatt gacctgcctg gtgaaaggcttctaccccag cgacatcgcc1141gttgagtggg agagtaacgg tcagcctgag aacaattacaagacaacccc cccagtgctg1201gatagtgacg ggtctttctt tctgtacagt aagctgactgtggacaagtc ccgctggcag1261cagggtaacg tcttcagctg ttccgtgatg cacgaggcattgcacaacca ctacacccag1321aagtcactga gcctgagccc agggaag Protein Sequence Defining the Full Length Sh14F11 IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:202) 1qvtlkesgpa lvkptqtltl tctfsgfsls tygmgvgwirqppgkalewl adiwwdddky61ynpslksrlt iskdtsknqv vltmtnmdpv dtavyycarrghysamdywg qgtlvtvssa121stkgpsvfpl apsskstsgg taalgclvkd yfpepvtvswnsgaltsgvh tfpavlqssg181lyslssvvtv pssslgtqty icnvnhkpsn tkvdkrvepkscdkthtcpp cpapellggp241svflfppkpk dtlmisrtpe vtcvvvdvsh edpevkfnwyvdgvevhnak tkpreeqyns301tyrvvsvltv lhqdwlngke ykckvsnkal papiektiskakgqprepqv ytlppsreem361tknqvsltcl vkgfypsdia vewesngqpe nnykttppvldsdgsfflys kltvdksrwq421qgnvfscsvm healhnhytq kslslspgk Nucleic Acid Sequence Encoding the Full Length Ch01G06 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:203) 1gacatccaaa tgacccagtc acccgcgagc ctttcggcgtcggtcggaga aacggtcacg61atcacgtgcc ggacatcaga gaatctccat aactacctcgcgtggtatca acagaagcag121gggaagtcgc cccagttgct tgtatacgat gcgaaaacgttggcggatgg ggtgccgtcc181agattctcgg gatcgggctc ggggacgcag tactcgctcaagatcaattc gctgcagccg241gaggactttg ggtcgtacta ttgtcagcat ttttggtcatcaccgtatac atttggaggt301ggaacgaaac ttgagattaa gcgcacagtt gctgcccccagcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtatgcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcacttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttattcactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcctgcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gt Protein Sequence Defining the Full Length Ch01G06 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:204) 1diqmtqspas lsasvgetvt itcrtsenlh nylawyqqkqgkspqllvyd aktladgvps61rfsgsgsgtq yslkinslqp edfgsyycqh fwsspytfgggtkleikrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsqesvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgec Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGKV1-39 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:205) 1gacatccaaa tgacccagtc gccgtcgtcg ctttcagcgtcggtagggga tcgggtcaca61attacgtgcc gaacgtcaga gaatttgcat aactacctcgcgtggtatca gcagaagccc121gggaagtcac cgaaactcct tgtctacgat gcgaaaacgctggcggatgg agtgccgtcg181agattctcgg gaagcggatc cggtacggac tatacgcttacgatctcatc gctccagccc241gaggactttg cgacgtacta ttgtcagcat ttttggtcgtcgccctacac atttgggcag301gggaccaagt tggaaatcaa gcgcacagtt gctgcccccagcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtatgcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcacttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttattcactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcctgcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gt Protein Sequence Defining the Full Length Hu01G06 IGKV1-39 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:206) 1diqmtqspss lsasvgdrvt itcrtsenlh nylawyqqkpgkspkllvyd aktladgvps61rfsgsgsgtd ytltisslqp edfatyycqh fwsspytfgqgtkleikrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsqesvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgec Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (also referred to herein as the full length Hu01G06 IGFV1-39 F1 Light Chain; SEQ ID NO:207) 1gacatccaaa tgacccagtc gccgtcgtcg ctttcagcgtcggtagggga tcgggtcaca61attacgtgcc gaacgtcaga gaatttgcat aactacctcgcgtggtatca gcagaagccc121gggaaggccc cgaaactcct tatctacgat gcgaaaacgctggcggatgg agtgccgtcg181agattctcgg gaagcggatc cggtacggac tatacgcttacgatctcatc gctccagccc241gaggactttg cgacgtacta ttgtcagcat ttttggtcgtcgccctacac atttgggcag301gggaccaagt tggaaatcaa gcgcacagtt gctgcccccagcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtatgcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcacttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttattcactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcctgcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gt Protein Sequence Defining the Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (also referred to herein as the full length Hu01G06 IGFV1-39 F1 Light Chain; SEQ ID NO:208) 1diqmtqspss lsasvgdrvt itcrtsenlh nylawyqqkpgkapklliyd aktladgvps61rfsgsgsgtd ytltisslqp edfatyycqh fwsspytfgqgtkleikrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsqesvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgec Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGKV1-39 V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:209) 1gacatccaaa tgacccagtc gccgtcgtcg ctttcagcgtcggtagggga tcgggtcaca61attacgtgcc gaacgtcaga gaatttgcat aactacctcgcgtggtatca gcagaagccc121gggaagtcac cgaaactcct tatctacgat gcgaaaacgctggcggatgg agtgccgtcg181agattctcgg gaagcggatc cggtacggac tatacgcttacgatctcatc gctccagccc241gaggactttg cgacgtacta ttgtcagcat ttttggtcgtcgccctacac atttgggcag301gggaccaagt tggaaatcaa gcgcacagtt gctgcccccagcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtatgcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcacttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttattcactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcctgcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gt Protein Sequence Defining the Full Length Hu01G06 IGKV1-39 V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:210) 1diqmtqspss lsasvgdrvt itcrtsenlh nylawyqqkpgkspklliyd aktladgvps61rfsgsgsgtd ytltisslqp edfatyycqh fwsspytfgqgtkleikrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsqesvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgec Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGKV1-39 F1 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (also referred to herein as the Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain; SEQ ID NO:207) 1gacatccaaa tgacccagtc gccgtcgtcg ctttcagcgtcggtagggga tcgggtcaca61attacgtgcc gaacgtcaga gaatttgcat aactacctcgcgtggtatca gcagaagccc121gggaaggccc cgaaactcct tatctacgat gcgaaaacgctggcggatgg agtgccgtcg181agattctcgg gaagcggatc cggtacggac tatacgcttacgatctcatc gctccagccc241gaggactttg cgacgtacta ttgtcagcat ttttggtcgtcgccctacac atttgggcag301gggaccaagt tggaaatcaa gcgcacagtt gctgcccccagcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtatgcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcacttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttattcactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcctgcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gt Protein Sequence Defining the Full Length Hu01G06 IGKV1-39 F1 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (also referred to herein as the Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain; SEQ ID NO:208) 1diqmtqspss lsasvgdrvt itcrtsenlh nylawyqqkpgkapklliyd aktladgvps61rfsgsgsgtd ytltisslqpedfatyycqhfwsspytfgqgtkleikrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsqesvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgec Nucleic Acid Sequence Encoding the Full Length Hu01G06 IGKV1-39 F2 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:263) 1gacatccaaa tgacccagtc gccgtcgtcg ctttcagcgtcggtagggga tcgggtcaca61attacgtgcc gaacgtcaga gaatttgcat aactacctcgcgtggtatca gcagaagccc121gggaagtcac cgaaactcct tatctacgat gcgaaaacgctggcggatgg agtgccgtcg181agattctcgg gaagcggatc cggtacggac tatacgcttacgatctcatc gctccagccc241gaggactttg cgacgtacta ttgtcagcat ttttggtcggacccctacac atttgggcag301gggaccaagt tggaaatcaa gcgcacagtt gctgcccccagcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtatgcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcacttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttattcactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcctgcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gt Protein Sequence Defining the Full Length Hu01G06 IGKV1-39 F2 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:264) 1diqmtqspss lsasvgdrvt itcrtsenlh nylawyqqkpgkspklliyd aktladgvps61rfsgsgsgtd ytltisslqp edfatyycqh fwsdpytfgqgtkleikrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsqesvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgec Nucleic Acid Sequence Encoding the Full Length Ch06C11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:211) 1gatatcgtca tgacccagtc ccagaagttc atgtcaacttcagtgggaga cagagtgtcc61gtcacatgta aagcctcgca aaatgtggga accaacgtagcgtggttcca gcagaaacct121ggccaatcac cgaaggcact gatctactcg gccagctataggtactcggg agtaccagat181cggtttacgg ggtcggggag cgggacggac tttatcctcactatttccaa tgtccagtcg241gaggaccttg cggaatactt ctgccagcag tataacaactatcccctcac gtttggtgct301ggtacaaaat tggagttgaa gcgcacagtt gctgcccccagcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtatgcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcacttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttattcactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcctgcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gt Protein Sequence Defining the Full Length Ch06C11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:212) 1divmtqsqkf mstsvgdrvs vtckasqnvg tnvawfqqkpgqspkaliys asyrysgvpd61rftgsgsgtd filtisnvqs edlaeyfcqq ynnypltfgagtklelkrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsqesvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgec Nucleic Acid Sequence Encoding the Full Length Sh06C11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:213) 1gacatccaaa tgacccaatc gccctcctcc ctctccgcatcagtagggga ccgcgtcaca61attacttgca aagcgtcgca gaacgtcgga acgaatgtggcgtggtttca gcagaagccc121ggaaaagctc cgaagagctt gatctactcg gcctcatataggtattcggg tgtgccgagc181cggtttagcg ggtcggggtc aggtactgat ttcacgctcacaatttcatc gttgcagcca241gaagatttcg ccacatatta ctgtcagcag tacaacaattaccctctgac gttcggccag301ggaaccaaac ttgagatcaa gcgcacagtt gctgcccccagcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtatgcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcacttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttattcactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcctgcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gt Protein Sequence Defining the Full Length Sh06C11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:214) 1diqmtqspss lsasvgdrvt itckasqnvg tnvawfqqkpgkapksliys asyrysgvps61rfsgsgsgtd ftltisslqp edfatyycqq ynnypltfgqgtkleikrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsqesvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgec Nucleic Acid Sequence Encoding the Full Length Ch14F11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:215) 1gacatcgtga tgacacagtc acagaaattc atgtccacatccgtcggtga tagagtatcc61gtcacgtgta aggcctcgca aaacgtagga actaatgtggcgtggtatca acagaagcca121ggacagtcac ccaaagcact catctacagc ccctcatatcggtacagcgg ggtgccggac181aggttcacgg gatcggggag cgggaccgat tttacactgaccatttcgaa tgtccagtcg241gaggaccttg cggaatactt ctgccagcag tataactcgtaccctcacac gtttggaggt301ggcactaagt tggagatgaa acgcacagtt gctgcccccagcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtatgcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcacttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttattcactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcctgcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gt Protein Sequence Defining the Full Length Ch14F11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:216) 1divmtqsqkf mstsvgdrvs vtckasqnvg tnvawyqqkpgqspkaliys psyrysgvpd61rftgsgsgtd ftltisnvqs edlaeyfcqq ynsyphtfgggtklemkrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsqesvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgec Nucleic Acid Sequence Encoding the Full Length Hu14F11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:217) 1gatatccaga tgacacagtc accctcgtcg ctctcagcttccgtaggcga cagggtcact61attacgtgta aagcatcaca gaacgtcgga acgaatgtggcgtggtttca gcagaagccc121gggaagagcc ccaaagcgct tatctactcc ccgtcgtatcggtattccgg tgtgccaagc181agattttcgg ggtcaggttc gggaactgac tttaccctgaccatctcgtc cctccaaccg241gaagatttcg ccacgtactt ctgccagcag tacaacagctatcctcacac attcggacaa301gggacaaagt tggagattaa acgcacagtt gctgcccccagcgtgttcat tttcccacct361agcgatgagc agctgaaaag cggtactgcc tctgtcgtatgcttgctcaa caacttttac421ccacgtgagg ctaaggtgca gtggaaagtg gataatgcacttcaatctgg aaacagtcaa481gagtccgtga cagaacagga cagcaaagac tcaacttattcactctcttc caccctgact541ctgtccaagg cagactatga aaaacacaag gtatacgcctgcgaggttac acaccagggt601ttgtctagtc ctgtcaccaa gtccttcaat aggggcgaat gt Protein Sequence Defining the Full Length Hu14F11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:218) 1diqmtqspss lsasvgdrvt itckasqnvg tnvawfqqkpgkspkaliys psyrysgvps61rfsgsgsgtd ftltisslqp edfatyfoqq ynsyphtfgqgtkleikrtv aapsvfifpp121sdeqlksgta svvcllnnfy preakvqwkv dnalqsgnsqesvteqdskd styslsstlt181lskadyekhk vyacevthqg lsspvtksfn rgec Table 22 is a concordance chart showing the SEQ ID NO. of each sequence discussed in this Example. TABLE 22SEQ ID NO.Nucleic Acid or Protein171Human IgG1 constant-nucleic acid172Human IgG1 constant-protein173Human Kappa constant-nucleic acid174Human Kappa constant-protein175Humanized Ch01G06 Chimeric Heavy Human Variable + Human IgG1 constant-nucleic acid176Humanized Ch01G06 Chimeric Heavy Human Variable + Human IgG1 constant-protein177Humanized Hu01G06 IGHV1-18 Heavy Human Variable + Human IgG1 constant-nucleic acid178Humanized Hu01G06 IGHV1-18 Heavy Human Variable + Human IgG1 constant-protein179Humanized Hu01G06 IGHV1-69 Heavy Human Variable + Human IgG1 constant-nucleic acid180Humanized Hu01G06 IGHV1-69 Heavy Human Variable + Human IgG1 constant-protein181Humanized Sh01G06 IGHV1-18 M69L Heavy Human Variable + Human IgG1 constant-nucleic acid182Humanized Sh01G06 IGHV1-18 M69L Heavy Human Variable + Human IgG1 constant-protein183Humanized Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Human Variable + Human IgG1 constant-nucleic acid184Humanized Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Human Variable + Human IgG1 constant-protein185Humanized Sh01G06 IGHV1-18 M69L K64Q Heavy Human Variable + Human IgG1 constant-nucleic acid186Humanized Sh01G06 IGHV1-18 M69L K64Q Heavy Human Variable + Human IgG1 constant-protein187Humanized Sh01G06 IGHV1-69 T30S I69L Heavy Human Variable + Human IgG1 constant-nucleic acid188Humanized Sh01G06 IGHV1-69 T30S I69L Heavy Human Variable + Human IgG1 constant-protein189Humanized Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Human Variable + Human IgG1 constant-nucleic acid190Humanized Sh01G06 IGHV1-69 T30S K64Q I69L Heavy Human Variable + Human IgG1 constant-protein255Humanized Hu01G06 IGHV1-18 F1 Heavy Human Variable + Human IgG1 constant-nucleic acid256Humanized Hu01G06 IGHV1-18 F1 Heavy Human Variable + Human IgG1 constant-protein257Humanized Hu01G06 IGHV1-18 F2 Heavy Human Variable + Human IgG1 constant-nucleic acid258Humanized Hu01G06 IGHV1-18 F2 Heavy Human Variable + Human IgG1 constant-protein259Humanized Hu01G06 IGHV1-69 F1 Heavy Human Variable + Human IgG1 constant-nucleic acid260Humanized Hu01G06 IGHV1-69 F1 Heavy Human Variable + Human IgG1 constant-protein261Humanized Hu01G06 IGHV1-69 F2 Heavy Human Variable + Human IgG1 constant-nucleic acid262Humanized Hu01G06 IGHV1-69 F2 Heavy Human Variable + Human IgG1 constant-protein191Humanized Ch06C11 Chimeric Heavy Human Variable + Human IgG1 constant-nucleic acid192Humanized Ch06C11 Chimeric Heavy Human Variable + Human IgG1 constant-protein193Humanized HE LM 06C11 IGHV2-70 Heavy Human Variable + Human IgG1 constant-nucleic acid194Humanized HE LM 06C11 IGHV2-70 Heavy Human Variable + Human IgG1 constant-protein195Humanized Hu06C11 IGHV2-5 Heavy Human Variable + Human IgG1 constant-nucleic acid196Humanized Hu06C11 IGHV2-5 Heavy Human Variable + Human IgG1 constant-protein197Humanized Ch14F11 Chimeric Heavy Human Variable + Human IgG1 constant-nucleic acid198Humanized Ch14F11 Chimeric Heavy Human Variable + Human IgG1 constant-protein199Humanized Sh14F11 IGHV2-5 Heavy Human Variable + Human IgG1 constant-nucleic acid200Humanized Sh14F11 IGHV2-5 Heavy Human Variable + Human IgG1 constant-protein201Humanized Sh14F11-IGHV2-70 Heavy Human Variable + Human IgG1 constant-nucleic acid202Humanized Sh14F11-IGHV2-70 Heavy Human Variable + Human IgG1 constant-protein203Humanized Ch01G06 Chimeric Human Variable + Human Kappa constant-nucleic acid204Humanized Ch01G06 Chimeric Human Variable + Human Kappa constant-protein205Humanized Hu01G06 IGKV1-39 Human Variable + Human Kappa constant-nucleic acid206Humanized Hu01G06 IGKV1-39 Human Variable + Human Kappa constant-protein207Humanized Hu01G06 IGKV1-39 S43A V48I Human Variable + Human Kappa constant-nucleic acid208Humanized Hu01G06 IGKV1-39 S43A V48I Human Variable + Human Kappa constant-protein209Humanized Hu01G06 IGKV1-39 V48I Human Variable + Human Kappa constant-nucleic acid210Humanized Hu01G06 IGKV1-39 V48I Human Variable + Human Kappa constant-protein207Humanized Hu01G06 IGKV1-39 F1 Human Variable + Human Kappa constant-nucleic acid208Humanized Hu01G06 IGKV1-39 F1 Human Variable + Human Kappa constant-protein263Humanized Hu01G06 IGKV1-39 F2 Human Variable + Human Kappa constant-nucleic acid264Humanized Hu01G06 IGKV1-39 F2 Human Variable + Human Kappa constant-protein211Humanized Ch06C11 Chimeric Human Variable + Human Kappa constant-nucleic acid212Humanized Ch06C11 Chimeric Human Variable + Human Kappa constant-protein213Humanized Sh06C11 IGKV1-16 Human Variable + Human Kappa constant-nucleic acid214Humanized Sh06C11 IGKV1-16 Human Variable + Human Kappa constant-protein215Humanized Ch14F11 Chimeric Human Variable + Human Kappa constant-nucleic acid216Humanized Ch14F11 Chimeric Human Variable + Human Kappa constant-protein217Humanized Hu14F11 IGKV1-16 Human Variable + Human Kappa constant-nucleic acid218Humanized Hu14F11 IGKV1-16 Human Variable + Human Kappa constant-protein Table 23 below shows antibodies containing chimeric immunoglobulin heavy and light chains and exemplary combinations of the full-length chimeric or humanized immunoglobulin heavy and light chains. TABLE 23Antibody NameLight ChainHeavy ChainHu01G06-1Humanized Ch01G06 ChimericHumanized Ch01G06 Chimeric HeavyHuman Variable + Human KappaHuman Variable + Human IgG1constant (SEQ ID NO: 204)constant (SEQ ID NO: 176)Hu01G06-46Humanized Hu01G06 IGKV1-39Humanized Hu01G06 IGHV1-18 HeavyHuman Variable + Human KappaHuman Variable + Human IgG1constant (SEQ ID NO: 206)constant (SEQ ID NO: 178)Hu01G06-52Humanized Hu01G06 IGKV1-39Humanized Hu01G06 IGHV1-69 HeavyHuman Variable + Human KappaHuman Variable + Human IgG1constant (SEQ ID NO: 206)constant (SEQ ID NO: 180)Hu01G06-100Humanized Hu01G06 IGKV1-39Humanized Sh01G06 IGHV1-18 M69LHuman Variable + Human KappaHeavy Human Variable + Human IgG1constant (SEQ ID NO: 206)constant (SEQ ID NO: 182)Hu01G06-101Humanized Hu01G06 IGKV1-39Humanized Sh01G06 IGHV1-18 M69LHuman Variable + Human KappaK64Q Heavy Human Variable + Humanconstant (SEQ ID NO: 206)IgG1 constant (SEQ ID NO: 186)Hu01G06-102Humanized Hu01G06 IGKV1-39Humanized Sh01G06 IGHV1-18 M69L K64QHuman Variable + Human KappaG44S Heavy Human Variable + Humanconstant (SEQ ID NO: 206)IgG1 constant (SEQ ID NO: 184)Hu01G06-103Humanized Hu01G06 IGKV1-39Humanized Sh01G06 IGHV1-69 T30SHuman Variable + Human KappaI69L Heavy Human Variable + Humanconstant (SEQ ID NO: 206)IgG1 constant (SEQ ID NO: 188)Hu01G06-104Humanized Hu01G06 IGKV1-39Humanized Sh01G06 IGHV1-69 T30S K64QHuman Variable + Human KappaI69L Heavy Human Variable + Humanconstant (SEQ ID NO: 206)IgG1 constant (SEQ ID NO: 190)Hu01G06-105Humanized Hu01G06 IGKV1-39 V48IHumanized Sh01G06 IGHV1-18 M69LHuman Variable + Human KappaHeavy Human Variable + Human IgG1constant (SEQ ID NO: 210)constant (SEQ ID NO: 182)Hu01G06-106Humanized Hu01G06 IGKV1-39 V48IHumanized Sh01G06 IGHV1-18 M69LHuman Variable + Human KappaK64Q Heavy Human Variable + Humanconstant (SEQ ID NO: 210)IgG1 constant (SEQ ID NO: 186)Hu01G06-107Humanized Hu01G06 IGKV1-39 V48IHumanized Sh01G06 IGHV1-18 M69L K64QHuman Variable + Human KappaG44S Heavy Human Variable + Humanconstant (SEQ ID NO: 210)IgG1 constant (SEQ ID NO: 184)Hu01G06-108Humanized Hu01G06 IGKV1-39 V48IHumanized Sh01G06 IGHV1-69 T30SHuman Variable + Human KappaI69L Heavy Human Variable + Humanconstant (SEQ ID NO: 210)IgG1 constant (SEQ ID NO: 188)Hu01G06-109Humanized Hu01G06 IGKV1-39 V48IHumanized Sh01G06 IGHV1-69 T30S K64QHuman Variable + Human KappaI69L Heavy Human Variable + Humanconstant (SEQ ID NO: 210)IgG1 constant (SEQ ID NO: 190)Hu01G06-110Humanized Hu01G06 IGKV1-39 S43AHumanized Sh01G06 IGHV1-18 M69LV48I Human Variable + Human KappaHeavy Human Variable + Humanconstant (SEQ ID NO: 208)IgG1 constant (SEQ ID NO: 182)Hu01G06-111Humanized Hu01G06 IGKV1-39 S43AHumanized Sh01G06 IGHV1-18 M69LV48I Human Variable + Human KappaK64Q Heavy Human Variable + Humanconstant (SEQ ID NO: 208)IgG1 constant (SEQ ID NO: 186)Hu01G06-112Humanized Hu01G06 IGKV1-39 S43AHumanized Sh01G06 IGHV1-18 M69LV48I Human Variable + Human KappaK64Q G44S Heavy Human Variable +constant (SEQ ID NO: 208)Human IgG1 constant (SEQ ID NO: 184)Hu01G06-113Humanized Hu01G06 IGKV1-39 S43AHumanized Sh01G06 IGHV1-69 T30SV48I Human Variable + Human KappaI69L Heavy Human Variable + Humanconstant (SEQ ID NO: 208)IgG1 constant (SEQ ID NO: 188)Hu01G06-114Humanized Hu01G06 IGKV1-39 S43AHumanized Sh01G06 IGHV1-69 T30S K64QV48I Human Variable + Human KappaI69L Heavy Human Variable + Humanconstant (SEQ ID NO: 208)IgG1 constant (SEQ ID NO: 190)Hu01G06-122Humanized Hu01G06 IGKV1-39 F1Humanized Hu01G06 IGHV1-18 F1Human Variable + Human KappaHeavy Human Variable + Human IgG1constant (SEQ ID NO: 208)constant (SEQ ID NO: 256)Hu01G06-127Humanized Hu01G06 IGKV1-39 F2Humanized Hu01G06 IGHV1-18 F2Human Variable + Human KappaHeavy Human Variable + Human IgG1constant (SEQ ID NO: 264)constant (SEQ ID NO: 258)Hu01G06-135Humanized Hu01G06 IGKV1-39 F1Humanized Hu01G06 IGHV1-69 F1Human Variable + Human KappaHeavy Human Variable + Human IgG1constant (SEQ ID NO: 208)constant (SEQ ID NO: 260)Hu01G06-138Humanized Hu01G06 IGKV1-39 F1Humanized Hu01G06 IGHV1-69 F2Human Variable + Human KappaHeavy Human Variable + Human IgG1constant (SEQ ID NO: 208)constant (SEQ ID NO: 262)Hu01G06-146Humanized Hu01G06 IGKV1-39 F2Humanized Hu01G06 IGHV1-69 F2Human Variable + Human KappaHeavy Human Variable + Human IgG1constant (SEQ ID NO: 264)constant (SEQ ID NO: 262)Hu06C11-1Humanized Ch06C11 ChimericHumanized Ch06C11 Chimeric HeavyHuman Variable + Human KappaHuman Variable + Human IgG1constant (SEQ ID NO: 212)constant (SEQ ID NO:176)Hu06C11-27Humanized Sh06C11 IGKV1-16Humanized HE LM 06C11 IGHV2-70Human Variable + Human KappaHeavy Human Variable + Human IgG1constant (SEQ ID NO: 214)constant (SEQ ID NO: 194)Hu06C11-30Humanized Sh06C11 IGKV1-16Humanized Hu06C11 IGHV2-5 HeavyHuman Variable + Human KappaHuman Variable + Human IgG1constant (SEQ ID NO: 214)constant (SEQ ID NO: 196)Hu14F11-1Humanized Ch14F11 ChimericHumanized Ch14F11 Chimeric HeavyHuman Variable + Human KappaHuman Variable + Human IgG1constant (SEQ ID NO: 216)constant (SEQ ID NO: 198)Hu14F11-23Humanized Ch14F11 ChimericHumanized Ch06C11 Chimeric HeavyHuman Variable + Human KappaHuman Variable + Human IgG1constant (SEQ ID NO: 216)constant (SEQ ID NO: 192)Hu14F11-24Humanized Ch06C11 ChimericHumanized Ch14F11 Chimeric HeavyHuman Variable + Human KappaHuman Variable + Human IgG1constant (SEQ ID NO: 212)constant (SEQ ID NO: 198)Hu14F11-39Humanized Hu14F11 IGKV1-16Humanized Sh14F11 IGHV2-5 HeavyHuman Variable + Human KappaHuman Variable + Human IgG1constant (SEQ ID NO: 218)constant (SEQ ID NO: 200)Hu14F11-47Humanized Hu14F11 IGKV1-16Humanized Sh14F11-IGHV2-70 HeavyHuman Variable + Human KappaHuman Variable + Human IgG1constant (SEQ ID NO: 218)constant (SEQ ID NO: 202) The antibody constructs containing the full length chimeric heavy and light chains are designated below: Chimeric 01G06 (Hu01G06-1)=Full Length Ch01G06 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:176) plus Full Length Ch01G06 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:204)Chimeric 06C11 (Hu06C11-1)=Full Length Ch06C11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:192) plus Full Length Ch06C11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:212)Chimeric 14F11 (Hu14F11-1)=Full Length Ch14F11 Chimeric Heavy Chain (Mouse Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:198) plus Full Length Ch14F11 Chimeric Light Chain (Mouse Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:216) Fifteen of the possible antibody constructs containing the full length immunoglobulin heavy and light chains containing humanized variable regions are designated below: Hu01G06-46=Full Length Hu01G06 IGHV1-18 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:178) plus Full Length Hu01G06 IGKV1-39 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:206)Hu01G06-52=Full Length Hu01G06 IGHV1-69 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:180) plus Full Length Hu01G06 IGKV1-39 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:206)Hu01G06-107=Full Length Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:184) plus Full Length Hu01G06 IGKV1-39 V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:210)Hu01G06-108=Full Length Sh01G06 IGHV1-69 T30S I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:188) plus Full Length Hu01G06 IGKV1-39 V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:210)Hu01G06-112=Full Length Sh01G06 IGHV1-18 M69L K64Q G44S Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:184) plus Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:208)Hu01G06-113=Full Length Sh01G06 IGHV1-69 T30S I69L Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:188) plus Full Length Hu01G06 IGKV1-39 S43A V48I Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:208)Hu01G06-122=Full Length Hu01G06 IGHV1-18 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:256) plus Full Length Hu01G06 IGKV1-39 F1 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:208)Hu01G06-127=Full Length Hu01G06 IGHV1-18 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:258) plus Full Length Hu01G06 IGKV1-39 F2 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:264)Hu01G06-135=Full Length Hu01G06 IGHV1-69 F1 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:260) plus Full Length Hu01G06 IGKV1-39 F1 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:208)Hu01G06-138=Full Length Hu01G06 IGHV1-69 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:262) plus Full Length Hu01G06 IGKV1-39 F1 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:208)Hu01G06-146=Full Length Hu01G06 IGHV1-69 F2 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:262) plus Full Length Hu01G06 IGKV1-39 F2 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:264)Hu06C11-27=Full Length HE LM 06C11 IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:194) plus Full Length Sh06C11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:214)Hu06C11-30=Full Length Hu06C11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:196) plus Full Length Sh06C11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:214)Hu14F11-39=Full Length Sh14F11 IGHV2-5 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:200) plus Full Length Hu14F11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:218)Hu14F11-47=Full Length Sh14F11-IGHV2-70 Heavy Chain (Humanized Heavy Chain Variable Region and Human IgG1 Constant Region) (SEQ ID NO:202) plus Full Length Hu14F11 IGKV1-16 Light Chain (Humanized Kappa Chain Variable Region and Human Kappa Constant Region) (SEQ ID NO:218) Example 15 Binding Affinities of Humanized and Chimeric Anti-GDF15 Monoclonal Antibodies The binding affinities and kinetics of binding of chimeric and humanized antibodies to mFc-rhGDF15 were measured by surface plasmon resonance, using a BIAcore® T100 instrument (GE Healthcare, Piscataway, N.J.). Goat anti-human IgGs (Fc fragment specific, Jackson ImmunoResearch, West Grove, Pa.) were immobilized on carboxymethylated dextran CM4 sensor chips by amine coupling, according to a standard protocol. Analyses were performed at 37° C. using PBS containing 0.05% surfactant P20 as running buffer. The antibodies were captured in individual flow cells at a flow rate of 10 μL/minute. Injection time was varied for each antibody to yield an Rmax between 30 and 60 RU. Buffer or mFc-rhGDF15 diluted in running buffer was injected sequentially over a reference surface (no antibody captured) and the active surface (antibody to be tested) for 240 seconds at 60 μL/minute. The dissociation phase was monitored for up to 1200 seconds. The surface was then regenerated with two 60-second injections of 10 mM Glycine-HCl, pH 2.25, at a flow rate of 30 μL/minute. The GDF15 concentration range tested was 20 nM to 0.625 nM. Kinetic parameters were determined using the kinetic function of the BIAevaluation software (GE Healthcare) with double reference subtraction. Kinetic parameters for each antibody, k a (association rate constant), k d (dissociation rate constant), and K D (equilibrium dissociation constant) were determined Kinetic values of purified monoclonal antibodies on mFc-rhGDF15 are summarized in Table 24. TABLE 24Antibodyk a (1/Ms)k d (1/s)K D (M)nHu01G06-14.2E+066.4E−041.6E−108Hu01G06-463.6E+063.8E−041.1E−1011Hu01G06-523.6E+063.6E−049.9E−1110Hu06C11-15.3E+068.4E−041.8E−102Hu06C11-274.7E+068.2E−041.8E−102Hu06C11-304.8E+068.7E−041.8E−102Hu14F11-13.0E+064.6E−041.6E−102Hu14F11-393.0E+061.9E−046.6E−112Hu14F11-473.3E+061.8E−046.5E−112 The results in Table 24 demonstrate that the chimeric and each of the humanized antibodies, have fast association rates (k a ), very slow disassociation rates (k d ) and very high affinities (K D ). In particular, the antibodies have affinities ranging from about 65 pM to about 200 pM. Kinetic values of chimeric 01G06 (Hu01G06-1), two initial lead humanized 01G06 monoclonal antibodies (Hu01G06-46 and -52), and sequence optimized humanized 01G06 monoclonal antibody variants Hu01G06-100 through -114 (in supernatant) on mFc-rhGDF15 are summarized in Table 25. TABLE 25Antibodyk a (1/Ms)k d (1/s)K D (M)nHu01G06-14.9E+067.1E−041.4E−103Hu01G06-464.1E+064.3E−041.0E−103Hu01G06-525.0E+064.4E−048.9E−113Hu01G06-1004.1E+066.2E−041.5E−103Hu01G06-1014.4E+066.3E−041.4E−103Hu01G06-1024.4E+064.6E−041.1E−103Hu01G06-1034.4E+064.7E−041.1E−103Hu01G06-1044.5E+065.2E−041.2E−103Hu01G06-1054.3E+065.6E−041.3E−103Hu01G06-1064.3E+067.0E−041.6E−103Hu01G06-1074.1E+064.7E−041.2E−103Hu01G06-1084.2E+064.6E−041.2E−103Hu01G06-1094.6E+065.6E−041.3E−104Hu01G06-1104.3E+065.8E−041.4E−104Hu01G06-1114.3E+066.6E−041.6E−103Hu01G06-1124.7E+065.3E−041.2E−103Hu01G06-1134.5E+064.8E−041.1E−103Hu01G06-1144.5E+065.4E−041.3E−103 The results in Table 25 demonstrate that the sequence optimized antibodies, Hu01G06-100 through -114, have binding affinities ranging from about 89 pM to about 160 pM. Binding affinities and binding kinetics of mFc-rhGDF15 with chimeric 14F11 (Hu14F11-1), chimeric light 14F11 with chimeric heavy 06C11 (Hu14F11-23), and chimeric light 06C11 with chimeric heavy 14F11 (Hu14F11-24) heavy monoclonal antibody variants (in supernatant) were measured using biolayer interferometry (BLI) on an Octet™ QK instrument (ForteBio, Inc., Menlo Park, Calif.). The Octet analysis was performed at 30° C. using 1× Kinetics Buffer (ForteBio, Inc.) as assay buffer. Anti-human IgG Fc Capture (AHC) biosensors (ForteBio, Inc.) were used to capture human antibodies onto the sensors. Sensors were saturated in assay buffer for at 300 seconds before the assay. Antibodies were loaded onto sensors by dipping the sensors into antibody supernatant solution for 220 seconds, which typically resulted in capture levels of 1.5-2 nm. Baseline was established by dipping the sensors into 1× assay buffer for 200 seconds. Next, association was monitored for 220 seconds in 400 nM mFc-rhGDF15 protein, and dissociation was followed for 600 seconds in buffer alone. Kinetic parameters for Hu14F11-1, Hu14F11-23, and Hu14F11-24 were determined using the kinetic function of the ForteBio Analysis Software Version 7.0. Kinetic parameters of the antibody, k a , k d , and K D were determined. Kinetic values of Hu14F11-1, Hu14F11-23, and Hu14F11-24 heavy monoclonal antibody variants (in supernatant) on mFc-rhGDF15 are summarized in Table 26. TABLE 26Antibodyk a (1/Ms)k d (1/s)K D (M)nHu14F11-16.3E+051.9E−053.2E−113Hu14F11-233.4E+056.2E−051.8E−101Hu14F11-247.1E+052.2E−043.1E−101 The results in Table 26 demonstrate that Hu14F11-23 and Hu14F11-24, (i.e., antibodies that consist of one chimeric 06C11 chain (heavy or light) mixed with one chimeric 14F11 chain (heavy or light)), retain binding to GDF15. In particular, these antibodies have high affinities ranging from about 180 pM to about 310 pM. Example 16 Binding Affinities of Affinity Matured Humanized Anti-GDF15 Monoclonal Antibodies The binding affinities and kinetics of binding of chimeric and humanized antibodies to mFc-rhGDF15, cleaved-rhGDF15, rabbit Fc mature recombinant mouse GDF15 (rFc-rmGDF15), and mouse Fc mature recombinant cynomolgus monkey GDF15 (mFc-rcGDF15) were measured by surface plasmon resonance, using a BIAcore® T100 instrument (GE Healthcare, Piscataway, N.J.). Goat anti-human IgGs (Fc fragment specific, Jackson ImmunoResearch, West Grove, Pa.) were immobilized on carboxymethylated dextran CM4 sensor chips by amine coupling, according to a standard protocol. Analyses were performed at 37° C. using PBS containing 0.05% surfactant P20 as running buffer. The antibodies were captured in individual flow cells at a flow rate of 10 μL/minute. Injection time was varied for each antibody to yield an Rmax between 30 and 60 RU. Buffer, mFc-rhGDF15, cleaved-rhGDF15, rFc-rmGDF15, or mFc-rcGDF15 diluted in running buffer was injected sequentially over a reference surface (no antibody captured) and the active surface (antibody to be tested) for 240 seconds at 60 μL/minute. The dissociation phase was monitored for up to 1500 seconds. The surface was then regenerated with two 60-second injections of 10 mM Glycine-HCl, pH 2.25, at a flow rate of 30 μL/minute. The GDF15 concentration range tested for each GDF15 protein was 5 nM to 0.3125 nM (two-fold dilutions). Kinetic parameters were determined using the kinetic function of the BIAevaluation software (GE Healthcare) with double reference subtraction. Kinetic parameters for each antibody, k a (association rate constant), k d (dissociation rate constant), and K D (equilibrium dissociation constant) were determined Kinetic values of purified monoclonal antibodies on mFc-rhGDF15, mature human GDF15, rFc-rmGDF15, and mFc-rcGDF15 are summarized in Table 27. TABLE 27ProteinAntibodyk a (1/Ms)k d (1/s)K D (M)nmFc-Hu01G06-1225.9E+062.1E−056.5E−125rhGDF15Hu01G06-1274.6E+064.2E−051.8E−114Hu01G06-1355.3E+064.4E−051.4E−115Hu01G06-1385.9E+064.1E−051.1E−115Hu01G06-1465.3E+062.6E−059.3E−125Cleaved-Hu01G06-1227.9E+063.4E−057.9E−124rhGDF15Hu01G06-1276.1E+063.6E−051.0E−114Hu01G06-1357.3E+066.2E−051.0E−114Hu01G06-1387.9E+062.5E−054.5E−124Hu01G06-1466.5E+065.2E−051.1E−114mFc-Hu01G06-1222.3E+062.4E−051.0E−114rcGDF15Hu01G06-1271.8E+061.6E−059.5E−124Hu01G06-1352.2E+067.9E−053.8E−114Hu01G06-1382.3E+065.3E−052.5E−114Hu01G06-1462.0E+061.5E−058.0E−124rFc-Hu01G06-1222.2E+071.4E−036.3E−112rmGDF15Hu01G06-1273.9E+072.1E−035.1E−112Hu01G06-1353.7E+071.9E−035.5E−112Hu01G06-1381.9E+078.0E−044.4E−112Hu01G06-1461.1E+077.2E−046.3E−112 The results in Table 27 demonstrate that the chimeric and each of the humanized antibodies, have fast association rates (k a ), very slow disassociation rates (k d ) and very high affinities (K D ). In particular, the antibodies have affinities ranging from less than 5 pM (e.g., about 4.5 pM) to about 65 pM. Example 17 Reversal of Cachexia in an HT-1080 Fibroscarcoma Xenograft Model This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by humanized 01G06, 06C11, 14F11 antibodies in an HT-1080 fibrosarcoma xenograft model. HT-1080 cells were grown in culture at 37° C. and inoculated subcutaneously into the flank of 8-week old female ICR-SCID mice as described above in Example 10. Body weight was measured daily. When body weight reached 93%, the mice were randomly divided into groups of ten mice each. Each group received one of the following treatments: murine IgG control, 01G06, 06C11, 14F11, and their respective humanized versions at 2 mg/kg. Treatment was administered once a day by intra-peritoneal injection. Antibody treatment with 01G06, Hu01G06-46 and Hu01G06-52 resulted in body weight increase to initial weight or 100% (p<0.001) ( FIG. 23 ). Statistical analysis was performed using ANOVA. Results for reversal of body weight on day in the HT-1080 model are shown in FIG. 23 and Table 28, respectively. TABLE 28Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to mIgG)1mIgG279.5NA201G06287.6p < 0.0013Hu01G06-46295.4p < 0.0014Hu01G06-52287.8p < 0.001 The data in FIG. 23 and Table 28 indicated that antibodies 01G06, Hu01G06-46 and Hu01G06-52 can reverse cachexia in an HT-1080 fibrosarcoma xenograft model. Antibody treatment with 06C11, Hu06C11-27, and Hu06C11-30 resulted in body weight increase relative to initial weight or about 100% (p<0.001) ( FIG. 24 ). Statistical analysis was performed using ANOVA. Results for reversal of body weight in the HT-1080 model are shown in FIG. 24 and Table 29. TABLE 29Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to mIgG)1mIgG287.7NA206C11293.6p < 0.0013Hu06C11-27293.2p < 0.0014Hu06C11-30289.8p < 0.01 The data in FIG. 24 and Table 29 indicate that antibodies 06C11, Hu06C11-27, and Hu06C11-30 can reverse cachexia in an HT-1080 fibrosarcoma xenograft model. Antibody treatment with 14F11, Hu14F11-39, and Hu14F11-47 resulted in body weight increase relative to initial weight or about 100% (p<0.001) ( FIG. 25 ). Statistical analysis was performed using ANOVA. Results for reversal of body weight in the HT-1080 model are shown in FIG. 25 and Table 30. TABLE 30Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to mIgG)1mIgG287.7NA214F11296.6p < 0.0013Hu14F11-39290.5p < 0.0014Hu14F11-47290.7p < 0.001 The data in FIG. 25 and Table 30 indicated that antibodies 14F11, Hu14F11-39, and Hu14F11-47 can reverse cachexia in an HT-1080 fibrosarcoma xenograft model. Antibody treatment with humanized 01G06 antibodies (i.e., antibodies Hu01G06-122, Hu01G06-127, Hu01G06-135, Hu01G06-138 and Hu01G06-146) resulted in body weight increase relative to initial weight or about 100% (p<0.001) ( FIG. 26 ). Statistical analysis was performed using ANOVA. Treatment with human IgG (hIgG) was used as a control. Results for reversal of body weights in the HT-1080 model are shown in FIG. 26 and Table 31. TABLE 31Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to hIgG)1hIgG284.2NA2Hu01G06-122296.3p < 0.0013Hu01G06-127296.1p < 0.0014Hu01G06-135293.5p < 0.0015Hu01G06-138291.9p < 0.0016Hu01G06-146292.7p < 0.001 The data in FIG. 26 and Table 31 indicated that humanized anti-GDF15 antibodies Hu01G06-122, Hu01G06-127, Hu01G06-135, Hu01G06-138 and Hu01G06-146 can reverse cachexia in an HT-1080 fibrosarcoma xenograft model. Example 18 Reversal of Cachexia in an mFc-rhGDF15-Induced Model This Example demonstrates the reversal of cachexia (as indicated by body weight loss) by humanized 01G06 antibodies (i.e., antibody Hu01G06-122, Hu01G06-127, Hu01G06-135, Hu01G06-138, or Hu01G06-146) in an mFc-rhGDF15-induced cachexia model. mFc-rhGDF15 (1 μg/g) was administered subcutaneously into the flank of 8-week old female ICR-SCID mice. Body weight was measured daily. When body weight reached 93%, the mice were randomly divided into six groups of ten mice each. Each group received one of the following treatments: human IgG control (hIgG), Hu01G06-122, Hu01G06-127, Hu01G06-135, Hu01G06-138 or Hu01G06-146 at 2 mg/kg. Treatment was administered once by intra-peritoneal injection. Treatment with antibody Hu01G06-122, Hu01G06-127, Hu01G06-135, Hu01G06-138 or Hu01G06-146 resulted in body weight increase relative to initial weight or about 100% (p<0.001) ( FIG. 27 and Table 32). TABLE 32Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to hIgG)1hIgG270.6NA2Hu01G06-1222101.7p < 0.0013Hu01G06-1272103.2p < 0.0014Hu01G06-1352102.5p < 0.0015Hu01G06-1382101.8p < 0.0016Hu01G06-1462102.5p < 0.001 The data in FIG. 27 and Table 32 indicate that the disclosed anti-GDF15 antibodies can reverse cachexia in an mFc-rhGDF15-induced mouse model (i.e., a non-tumor bearing mouse model). These results indicate that humanized anti-GDF15 antibodies can reverse cachexia in an mFc-rhGDF15-induced cachexia model. Example 19 Dose Response Reversal of Cachexia in an HT-1080 Fibroscarcoma Xenograft Model This Example demonstrates the dose response reversal of cachexia (as indicated by body weight loss) by humanized Hu01G06-127 and Hu01G06-135 antibodies in an HT-1080 fibrosarcoma xenograft model. HT-1080 cells were grown in culture at 37° C. and inoculated subcutaneously into the flank of 8-week old female ICR-SCID mice as described above in Example 10. Body weight was measured daily. When body weight reached 93%, the mice were randomly divided into groups of ten mice each. Each group received one of the following treatments: human IgG control (hIgG; 20 mg/kg), Hu01G06-127 (20 mg/kg, 2 mg/kg, or 0.2 mg/kg) and Hu01G06-135 (20 mg/kg, 2 mg/kg, or 0.2 mg/kg). Treatment was administered once a day by intravenous injection. Antibody treatment with Hu01G06-127 and Hu01G06-135 at 20 mg/kg resulted in body weight increase above the initial weight or 108% (p<0.001) ( FIG. 28 ). Antibody treatment with Hu01G06-127 and Hu01G06-135 at 2 mg/kg resulted in limited body weight decrease compare to control (hIgG) from the initial weight or 88-85% (p<0.001) ( FIG. 28 ). Statistical analysis was performed using ANOVA. Results for changes of body weight at the end of the study in the HT-1080 model are shown in FIG. 28 and Table 33. TABLE 33Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to hIgG)1hIgG2075.2NA2Hu01G06-12720108.9p < 0.0013Hu01G06-1272.088.1p < 0.0014Hu01G06-1270.280.0NS5Hu01G06-13520108.6p < 0.0016Hu01G06-1352.085.2p < 0.017Hu01G06-1350.277.3NS The data in FIG. 28 and Table 33 indicated that antibodies Hu01G06-127 and Hu01G06-135 can reverse cachexia in an HT-1080 fibrosarcoma xenograft model in a dose-dependent manner. Example 20 Reversal of Muscle and Fat Loss in an HT-1080 Xenograft Tumor Model This Example demonstrates the reversal of cachexia (as indicated by body weight loss, muscle mass loss and fat mass loss) by antibody 01G06 in an HT-1080 fibrosarcoma xenograft model. HT-1080 cells were grown in culture at 37° C. in an atmosphere containing 5% CO 2 , using Eagle's Minimum Essential Medium (ATCC, Catalog No. 30-2003) containing 10% FBS. Cells were inoculated subcutaneously into the flank of 8-week old female ICR SCID mice with 5×10 6 cells per mouse in 50% matrigel. A cohort of ten 8-week old female ICR SCID mice with the same body weight was selected for subcutaneous inoculation into the flank with matrigel, as a non tumor (SHAM) control arm. Body weight was measured daily. When body weight reached 91% in the tumor bearing mice, the mice were randomly divided into two groups of ten mice each. Each group received one of the following treatments: human IgG control (hIgG) or Hu01G06-127 10 mg/kg on day 1, day 3 and day 6. Treatment was administered by intra-peritoneal injection. Treatment with antibody Hu01G06-127 resulted in body weight increase to 105% of initial weight compared to non-tumor bearing control mice (SHAM; p<0.001) ( FIG. 29A and Table 34). TABLE 34Treatment% BodyANOVA AnalysisGr.Agentmg/kgweight(compared to hIgG)1hIgG1084.3NA2Hu01G06-12710105.4p < 0.0012SHAM no tumor controlnone101.9p < 0.001 The data in FIG. 29A and Table 34 indicate that the disclosed anti-GDF15 antibody can completely reverse cachexia in an HT-1080 fibrosarcoma xenograft model. In this experiment, a group of ten mice were sacrificed at the time of dosing (baseline or 91% body weight loss, without treatment) and at the end of the study (eight days post dose, either hIgG or Hu01G06-127 as well SHAM non tumor control mice). Gonadal fat and the gastrocnemius muscles were removed surgically and weighed. As shown in FIG. 29B , significant gonadal fat mass loss was observed seven days post dose with hIgG, but not in the group treated with antibody Hu01G06-127 compared to baseline control (91% body weight loss). Moreover, treatment with Hu01G06-127 not only prevented further fat loss (compared to baseline group), but also, was able to restore the normal levels of gonadal fat (compared to SHAM non-tumor control) ( FIG. 29B ). In addition, significant gastrocnemius muscle mass loss was observed seven days post dose with hIgG, but not in the group treated with antibody Hu01G06-127 compared to baseline control (91% body weight loss) ( FIG. 29C ). Treatment with Hu01G06-127 not only prevented further muscle loss (compare to baseline group), but also was able to restore the normal levels of gastrocnemius muscle (compared to SHAM non tumor control) ( FIG. 29C ). These results indicate that the disclosed anti-GDF15 antibodies can completely reverse cachexia measured by the loss of muscle mass, loss of fat and involuntary weight loss in an HT-1080 xenograft tumor model. INCORPORATION BY REFERENCE The entire disclosure of each of the patent documents and scientific articles referred to herein is incorporated by reference for all purposes. EQUIVALENTS The invention may be embodied in other specific forms without departing from the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting on the invention described herein. Scope of the invention is thus indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and the range of equivalency of the claims are intended to be embraced therein.","lang":"en","source":"USPTO_FULLTEXT","data_format":"ORIGINAL"}},"description_lang":["en"],"has_description":true,"has_docdb":true,"has_inpadoc":true,"has_full_text":true,"biblio_lang":"en"},"jurisdiction":"US","collections":[],"usersTags":[],"lensId":"040-676-874-921-89X","publicationKey":"US_9175076_B2","displayKey":"US 9175076 B2","docAssets":{"lensId":"040-676-874-921-89X","pdfUrl":"https://www.lens.org/images/patent/US/9175076/B2/US_9175076_B2.pdf","images":[{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000001.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000001.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000002.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000002.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000003.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000003.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000004.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000004.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000005.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000005.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000006.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000006.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000007.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000007.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000008.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000008.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000009.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000009.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000010.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000010.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000011.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000011.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000012.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000012.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000013.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000013.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000014.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000014.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000015.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000015.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000016.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000016.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000017.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000017.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000018.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000018.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000019.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000019.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000020.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000020.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000021.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000021.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000022.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000022.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000023.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000023.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000024.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000024.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000025.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000025.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000026.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000026.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000027.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000027.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000028.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000028.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000029.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000029.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000030.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000030.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000031.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000031.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000032.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000032.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000033.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000033.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000034.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000034.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000035.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000035.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000036.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000036.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000037.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000037.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000038.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000038.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000039.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000039.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000040.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000040.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000041.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000041.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000042.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000042.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000043.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000043.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000044.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000044.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000045.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000045.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000046.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000046.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000047.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000047.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000048.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000048.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000049.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000049.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000050.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000050.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000051.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000051.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000052.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000052.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000053.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000053.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000054.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000054.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000055.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000055.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000056.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000056.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000057.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000057.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000058.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000058.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000059.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000059.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000060.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000060.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000061.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000061.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000062.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000062.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000063.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000063.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000064.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000064.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000065.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000065.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000066.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000066.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000067.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000067.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000068.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000068.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000069.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000069.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000070.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000070.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000071.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000071.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000072.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000072.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000073.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000073.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000074.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000074.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000075.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000075.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000076.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000076.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000077.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000077.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000078.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000078.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000079.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000079.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000080.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000080.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000081.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000081.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000082.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000082.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000083.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000083.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000084.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000084.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000085.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000085.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000086.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000086.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000087.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000087.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000088.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000088.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000089.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000089.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000090.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000090.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000091.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000091.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000092.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000092.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000093.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000093.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000094.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000094.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000095.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000095.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000096.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000096.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000097.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000097.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000098.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000098.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000099.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000099.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000100.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000100.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000101.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000101.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000102.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000102.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000103.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000103.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000104.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000104.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000105.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000105.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000106.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000106.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000107.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000107.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000108.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000108.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000109.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000109.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000110.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000110.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000111.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000111.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000112.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000112.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000113.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000113.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000114.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000114.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000115.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000115.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000116.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000116.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000117.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000117.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000118.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000118.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000119.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000119.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000120.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000120.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000121.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000121.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000122.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000122.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000123.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000123.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000124.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000124.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000125.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000125.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000126.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000126.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000127.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000127.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000128.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000128.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000129.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000129.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000130.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000130.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000131.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000131.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000132.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000132.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000133.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000133.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000134.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000134.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000135.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000135.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000136.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000136.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000137.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000137.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000138.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000138.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000139.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000139.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000140.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000140.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000141.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000141.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000142.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000142.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000143.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000143.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000144.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000144.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000145.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000145.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000146.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000146.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000147.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000147.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000148.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000148.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000149.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000149.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000150.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000150.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000151.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000151.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000152.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000152.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000153.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000153.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000154.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000154.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000155.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000155.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000156.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000156.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000157.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000157.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000158.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000158.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000159.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000159.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000160.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000160.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000161.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000161.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000162.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000162.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000163.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000163.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000164.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000164.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000165.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000165.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000166.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000166.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000167.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000167.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000168.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000168.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000169.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000169.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000170.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000170.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000171.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000171.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000172.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000172.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000173.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000173.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000174.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000174.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000175.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000175.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000176.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000176.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000177.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000177.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000178.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000178.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000179.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000179.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000180.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000180.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000181.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000181.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000182.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000182.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000183.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000183.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000184.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000184.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000185.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000185.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000186.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000186.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000187.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000187.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000188.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000188.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000189.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000189.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000190.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000190.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000191.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000191.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000192.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000192.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000193.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000193.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000194.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000194.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000195.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000195.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000196.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000196.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000197.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000197.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000198.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000198.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000199.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000199.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000200.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000200.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000201.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000201.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000202.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000202.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000203.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000203.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000204.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000204.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000205.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000205.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000206.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000206.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000207.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000207.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000208.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000208.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000209.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000209.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000210.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000210.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000211.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000211.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000212.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000212.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000213.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000213.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000214.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000214.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000215.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000215.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000216.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000216.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000217.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000217.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000218.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000218.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000219.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000219.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000220.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000220.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000221.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000221.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000222.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000222.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000223.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000223.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000224.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000224.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000225.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000225.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000226.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000226.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000227.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000227.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000228.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000228.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000229.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000229.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000230.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000230.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000231.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000231.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000232.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000232.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000233.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000233.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000234.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000234.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000235.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000235.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000236.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000236.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000237.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000237.png"},{"thumb":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/10pc/00000238.png","full":"https://s3-us-west-2.amazonaws.com/lens-resource/patent/US/B2/9175/9175076/image/page/full/00000238.png"}],"fallover":false},"countryName":"USA","inventorModel":{"inventors":[{"name":{"value":"LERNER LORENA","valueNormalised":"Lerner Lorena"},"inventorship":null},{"name":{"value":"ABBOTT SANDRA","valueNormalised":"Abbott Sandra"},"inventorship":null},{"name":{"value":"BAI AILIN","valueNormalised":"Bai Ailin"},"inventorship":null},{"name":{"value":"CHEN TING","valueNormalised":"Chen Ting"},"inventorship":null},{"name":{"value":"CHIU MARIA ISABEL","valueNormalised":"Chiu Maria Isabel"},"inventorship":null},{"name":{"value":"LIU QING","valueNormalised":"Liu Qing"},"inventorship":null},{"name":{"value":"POLING LAURA","valueNormalised":"Poling Laura"},"inventorship":null},{"name":{"value":"TAO NIANJUN","valueNormalised":"Tao Nianjun"},"inventorship":null},{"name":{"value":"WEILER SOLLY","valueNormalised":"Weiler Solly"},"inventorship":null},{"name":{"value":"WENG ZHIGANG","valueNormalised":"Weng Zhigang"},"inventorship":null},{"name":{"value":"WINSTON JR WILLIAM M","valueNormalised":"Winston Jr William M"},"inventorship":null},{"name":{"value":"GYURIS JENO","valueNormalised":"Gyuris Jeno"},"inventorship":null}],"inventorships":[],"unmatchedInventorships":[],"activeUserHasInventorship":false},"simpleFamilyId":184105523,"citesPatentCount":38,"countrySpec":{"countryName":"USA","description":"GRANTED PATENT AS SECOND PUBLICATION [FROM 2001 ONWARDS]","rule":"pubdate:AFTER:01-01-2001","docType":"GRANTED_PATENT"},"pageTitle":"US 9175076 B2 - Anti-GDF15 antibodies","documentTitle":"Anti-GDF15 antibodies"},"claims":{"source":"xml_claims","claims":[{"lines":["An isolated antibody that binds human GDF15 comprising an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region selected from the group consisting of:\n
(a) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:38 (Hu01G06 IGHV1-18 F2), a CDRH2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:237 and SEQ ID NO:241 (Hu01G06 IGHV1-18 F2), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-18 F2); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F2), a CDRL2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F2), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2);\n
(b) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F1), a CDRH2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:238 and SEQ ID NO:241 (Hu01G06 IGHV1-69 F1), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F1); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDRL2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1);\n
(c) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:1 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-69 T3OS I69L), a CDRH2 comprising the amino acid sequence of SEQ ID NO:7 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-69 T30S I69L), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:15 (01G06, Ch01G06 Chimeric, Hu01G06 IGHV1-18, Hu01G06 IGHV1-69, Sh01G06 IGHV1-18 M69L, Sh01G06 IGHV1-69 T30S I69L); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), a CDRL2 comprising the amino acid sequence of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I);\n
(d) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:2 (03G05), a CDRH2 comprising the amino acid sequence of SEQ ID NO:8 (03G05), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:16 (03G05); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:22 (03G05), a CDRL2 comprising the amino acid sequence of SEQ ID NO:27 (03G05), and a CDRL3 comprising the amino acid sequence of SEQ ID NO 33 (03G05);\n(e) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:3 (04F08), a CDRH2 comprising the amino acid sequence of SEQ ID NO:9 (04F08), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:17 (04F08); and\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:23 (04F08), a CDRL2 comprising the amino acid sequence of SEQ ID NO:28 (04F08), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:34 (04F08);\n
(f) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:4 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), a CDRH2 comprising the amino acid sequence of SEQ ID NO:9 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:18 (06C11, Ch06C11 Chimeric, Hu06C11 IGHV2-5); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:23 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), a CDRL2 comprising the amino acid sequence of SEQ ID NO:28 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:35 (06C11, Ch06C11 Chimeric, Sh06C11 IGKV1-16);\n
(g) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:1 (08G01), a CDRH2 comprising the amino acid sequence of SEQ ID NO:10 (08G01), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:15 (08G01); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:24 (08G01), a CDRL2 comprising the amino acid sequence of SEQ ID NO:29 (08G01), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:32 (08G01);\n
(h) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:5 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), a CDRH2 comprising the amino acid sequence of SEQ ID NO:11 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:19 (14F11, Ch14F11 Chimeric, Sh14F11 IGHV2-5, Sh14F11 IGHV2-70); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:23 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), a CDRL2 comprising the amino acid sequence of SEQ ID NO:30 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:36 (14F11, Ch14F11 Chimeric, Hu14F11 IGKV1-16);\n
(i) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:6 (17B11), a CDRH2 comprising the amino acid sequence of SEQ ID NO:12 (17B11), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:20 (17B11); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:25 (17B11), a CDRL2 comprising the amino acid sequence of SEQ ID NO:31 (17B11), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:37 (17B11);\n(j) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:1 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L), a CDRH2 comprising the amino acid sequence of SEQ ID NO:13 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:15 (Sh01G06 IGHV1-18 M69L K64Q G44S, Sh01G06 IGHV1-18 M69L K64Q, Sh01G06 IGHV1-69 T30S K64Q I69L); and\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:21 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), a CDRL2 comprising the amino acid sequence of SEQ ID NO:26 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:32 (01G06, Ch01G06 Chimeric, Hu01G06 IGKV1-39, Hu01G06 IGKV1-39 S43A V48I, Hu01G06 IGKV1-39 V48I);\n
(k) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:38 (Hu01G06 IGHV1-18 F1), a CDRH2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:236 and SEQ ID NO:240 (Hu01G06 IGHV1-18 F1), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-18 F1); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDRL2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1);\n
(l) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F2), a CDRH2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:239 and SEQ ID NO:240 (Hu01G06 IGHV1-69 F2), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F2); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F1), a CDRL2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F1), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:32 (Hu01G06 IGKV1-39 F1);\n
(m) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and SEQ ID NO:234 (Hu01G06 IGHV1-69 F2), a CDRH2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:239 and SEQ ID NO:240 (Hu01G06 IGHV1-69 F2), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:15 (Hu01G06 IGHV1-69 F2); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:21 (Hu01G06 IGKV1-39 F2), a CDRL2 comprising the amino acid sequence of SEQ ID NO:26 (Hu01G06 IGKV1-39 F2), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:244 (Hu01G06 IGKV1-39 F2);\n
(n) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:4 (HE LM 06C11 IGHV2-70), a CDRH2 comprising the amino acid sequence of SEQ ID NO:14 (HE LM 06C11 IGHV2-70), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:18 (HE LM 06C11 IGHV2-70); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:23 (Ch06C11 Chimeric, Sh06C11 IGKV1-16), a CDRL2 comprising the amino acid sequence of SEQ ID NO:28 (Ch06C11 Chimeric, Sh06C11 IGKV1-16), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:35 (Ch06C11 Chimeric, Sh06C11 IGKV1-16);\n
(o) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:4 (Ch06C11 Chimeric), a CDRH2 comprising the amino acid sequence of SEQ ID NO:9 (Ch06C11 Chimeric), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:18 (Ch06C11 Chimeric); and\n\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:23 (Ch14F11 Chimeric), a CDRL2 comprising the amino acid sequence of SEQ ID NO:30 (Ch14F11 Chimeric), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:36 (Ch14F11 Chimeric); and\n
(p) (i) an immunoglobulin heavy chain variable region comprising a CDRH1 comprising the amino acid sequence of SEQ ID NO:5 (Ch14F11 Chimeric), a CDRH2 comprising the amino acid sequence of SEQ ID NO:11 (Ch14F11 Chimeric), and a CDRH3 comprising the amino acid sequence of SEQ ID NO:19 (Ch14F11 Chimeric); and\n"],"number":1,"annotation":false,"claim":true,"title":false},{"lines":["The antibody of claim 1, wherein the CDR sequences are interposed between human or humanized framework sequences."],"number":2,"annotation":false,"claim":true,"title":false},{"lines":["An isolated nucleic acid comprising a nucleotide sequence encoding an immunoglobulin heavy chain variable region of claim 1."],"number":3,"annotation":false,"claim":true,"title":false},{"lines":["An isolated nucleic acid comprising a nucleotide sequence encoding an immunoglobulin light chain variable region of claim 1."],"number":4,"annotation":false,"claim":true,"title":false},{"lines":["An expression vector comprising the nucleic acid of claim 3."],"number":5,"annotation":false,"claim":true,"title":false},{"lines":["An expression vector comprising the nucleic acid of claim 4."],"number":6,"annotation":false,"claim":true,"title":false},{"lines":["A host cell comprising the expression vector of claim 5."],"number":7,"annotation":false,"claim":true,"title":false},{"lines":["A host cell comprising the expression vector of claim 6."],"number":8,"annotation":false,"claim":true,"title":false},{"lines":["A method of producing a polypeptide comprising an immunoglobulin heavy chain variable region or an immunoglobulin light chain variable region, the method comprising:\n(ii) an immunoglobulin light chain variable region comprising a CDRL1 comprising the amino acid sequence of SEQ ID NO:23 (Ch06C11 Chimeric), a CDRL2 comprising the amino acid sequence of SEQ ID NO:28 (Ch06C11 Chimeric), and a CDRL3 comprising the amino acid sequence of SEQ ID NO:35 (Ch06C11 Chimeric).\n
(a) growing the host cell of claim 8 under conditions so that the host cell expresses the polypeptide comprising the immunoglobulin heavy chain variable region or the immunoglobulin light chain variable region; and\n
(b) purifying the polypeptide comprising the immunoglobulin heavy chain variable region or the immunoglobulin light chain variable region."],"number":9,"annotation":false,"claim":true,"title":false},{"lines":["An isolated antibody that binds human GDF15, comprising an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region selected from the group consisting of:\n
(a) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:248 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2);\n
(b) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:250 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1);\n
(c) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (01G06, Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (01G06, Ch01G06 Chimeric);\n
(d) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:42 (03G05), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:78 (03G05);\n
(e) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:44 (04F08), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:80 (04F08);\n
(f) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (06C11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (06C11);\n
(g) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:48 (08G01), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:84 (08G01);\n
(h) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (14F11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (14F11);\n
(i) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:52 (17B11), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:88 (17B11);\n
(j) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric);\n
(k) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric);\n
(l) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric);\n
(m) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric);\n
(n) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric);\n
(o) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric);\n
(p) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:76 (Ch01G06 Chimeric);\n
(q) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39);\n
(r) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39);\n
(s) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39);\n
(t) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39);\n
(u) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39);\n
(v) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39);\n
(w) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39);\n
(x) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:90 (Hu01G06 IGKV1-39);\n
(y) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I);\n
(z) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I);\n
(aa) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I);\n
(bb) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I);\n
(cc) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I);\n
(dd) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I);\n
(ee) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I);\n
(ff) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 S43A V48I);\n
(gg) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:40 (Ch01G06 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I);\n
(hh) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:54 (Hu01G06 IGHV1-18), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I);\n
(ii) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:56 (Hu01G06 IGHV1-69), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I);\n
(jj) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:58 (Sh01G06 IGHV1-18 M69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I);\n
(kk) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:60 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I);\n
(ll) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:62 (Sh01G06 IGHV1-18 M69L K64Q), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I);\n
(mm) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:64 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I);\n
(nn) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:66 (Sh01G06 IGHV1-69 T30S K64Q I69L), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:94 (Hu01G06 IGKV1-39 V48I);\n
(oo) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:246 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1);\n
(pp) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:92 (Hu01G06 IGKV1-39 F1);\n
(qq) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:252 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:254 (Hu01G06 IGKV1-39 F2);\n
(rr) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:68 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric);\n
(ss) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:70 (Hu06C11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:82 (Ch06C11 Chimeric);\n
(tt) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:46 (Ch06C11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16);\n
(uu) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:68 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16);\n
(vv) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:70 (Hu06C11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:96 (Sh06C11 IGKV1-16);\n
(ww) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:72 (Sh14F11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric);\n
(xx) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:86 (Ch14F11 Chimeric);\n
(yy) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:50 (Ch14F11 Chimeric), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16);\n
(zz) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:72 (Sh14F11 IGHV2-5), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16); and\n
(aaa) an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO:74 (Sh14F11 IGHV2-70), and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:98 (Hu14F11 IGKV1-16)."],"number":10,"annotation":false,"claim":true,"title":false},{"lines":["An isolated antibody that binds human GDF15 comprising an immunoglobulin heavy chain and an immunoglobulin light chain selected from the group consisting of:\n
(a) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:258 (Hu01G06 IGHV1-18 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:264 (Hu01G06 IGKV1-39 F2);\n
(b) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:260 (Hu01G06 IGHV1-69 F1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1);\n
(c) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:176 (Ch01G06 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:204 (Ch01G06 Chimeric);\n
(d) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:192 (Ch06C11 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:212 (Ch06C11 Chimeric);\n
(e) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:198 (Ch14F11 Chimeric), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:216 (Ch14F11 Chimeric);\n
(f) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:178 (Hu01G06 IGHV1-18), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39);\n
(g) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:180 (Hu01G06 IGHV1-69), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:206 (Hu01G06 IGKV1-39);\n
(h) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I);\n
(i) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:210 (Hu01G06 IGKV1-39 V48I);\n
(j) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:184 (Sh01G06 IGHV1-18 M69L K64Q G44S), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I);\n
(k) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:188 (Sh01G06 IGHV1-69 T30S I69L), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 S43A V48I);\n
(l) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:256 (Hu01G06 IGHV1-18 F1), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1);\n
(m) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:208 (Hu01G06 IGKV1-39 F1);\n
(n) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:262 (Hu01G06 IGHV1-69 F2), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:264 (Hu01G06 IGKV1-39 F2);\n
(o) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:194 (HE LM 06C11 IGHV2-70), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:214 (Sh06C11 IGKV1-16);\n
(p) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:196 (Hu06C11 IGHV2-5), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:214 (Sh06C11 IGKV1-16);\n
(q) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:200 (Sh14F11 IGHV2-5), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:218 (Hu14F11 IGKV1-16); and\n
(r) an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:202 (Sh14F11 IGHV2-70), and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:218 (Hu14F11 IGKV1-16)."],"number":11,"annotation":false,"claim":true,"title":false}]}},"filters":{"npl":[],"notNpl":[],"applicant":[],"notApplicant":[],"inventor":[],"notInventor":[],"owner":[],"notOwner":[],"tags":[],"dates":[],"types":[],"notTypes":[],"j":[],"notJ":[],"fj":[],"notFj":[],"classIpcr":[],"notClassIpcr":[],"classNat":[],"notClassNat":[],"classCpc":[],"notClassCpc":[],"so":[],"notSo":[],"sat":[]},"sequenceFilters":{"s":"SEQIDNO","d":"ASCENDING","p":0,"n":10,"sp":[],"si":[],"len":[],"t":[],"loc":[]}}